SecReT6
Protein ID: 336173407
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2274
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2539072..2539506 [+]
ProductgpW/GP25 family protein
NoteTssE
UniProt IDF6GGR7
KEGG IDlan:Lacal_2274
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.00E-08, Aligned region: 25..125
Protein Sequence: 144 a.a.     [Download]
>gi|336173407|ref|YP_004580545.1| gpW/GP25 family protein [Lacinutrix sp. 5H-3-7-4]
MIKNYYELPLKPANFFTKKEHDTCDIKQSIAHYIHLINTSHFGECSFDETFGSSIWELDFDNLKSSNKLK
SIIKQSLEEAIKEHEKRLVNVIVEAKIKQEEILDNNTLNRIKKRVDLVIRAKVKKTNETFKYVEYFYIGP
LSYQ
 
Nucleotide Sequence: 435 bp     [Download]
>gi|336171143|ref|NC_015638.1|:2539072-2539506 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGATTAAAAACTATTACGAATTACCTCTAAAACCAGCTAATTTTTTTACTAAAAAAGAGCACGATACTT
GTGATATTAAACAATCGATAGCACATTATATTCACTTAATAAATACATCTCATTTTGGAGAATGTAGTTT
TGATGAAACTTTTGGAAGCTCTATTTGGGAATTAGATTTCGATAATTTAAAGAGTTCTAATAAATTAAAA
TCTATAATTAAGCAGTCTCTAGAAGAGGCTATAAAAGAACACGAAAAAAGATTAGTTAATGTTATTGTAG
AGGCTAAAATTAAGCAAGAAGAAATTTTAGATAATAACACATTAAATAGAATAAAAAAAAGAGTAGATCT
GGTAATTAGGGCAAAAGTTAAAAAAACCAACGAGACTTTTAAATATGTTGAGTACTTTTACATAGGTCCA
TTATCTTACCAATAA