SecReT6
Protein ID: 336173409
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2276
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2541387..2542382 [+]
ProductPKD domain-containing protein
NoteTssP
UniProt IDF6GGR9
KEGG IDlan:Lacal_2276
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 2.60E-14, Aligned region: 54..104
PKD [PF00801], Evalue: 2.60E-14, Aligned region: 139..187
Protein Sequence: 331 a.a.     [Download]
>gi|336173409|ref|YP_004580547.1| PKD domain-containing protein [Lacinutrix sp. 5H-3-7-4]
MSKYNNSSSHIDKTVIYVFLFVFFASISVFAYRYTKYSPCENVTFNIDKAQNTVGELIKFKDVTDTAESW
YWDFGDNSIASTQKEPLHVYKTPGDYTVKLIVNDICEATQTVSIAEKKEVLDPTKFPIFELQKTIKVGQK
LRVNDETENASTWEWRFGETAKINANTKRASYVYTEPGLKTVSLVVNGDLKYVTKKTIEVLPLAETKRKP
IDIPQAPSKPSVDIKYKPESAIKDKPSTPKLAPYISEADFKAKMMKVSKEEMSAKQFSEYFCGDINKKIV
ANGRNTTFLVFCEKISDKKIRIKKLEIFRDKGSNCINTITIDCRIRGLFND
 
Nucleotide Sequence: 996 bp     [Download]
>gi|336171143|ref|NC_015638.1|:2541387-2542382 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGAGCAAGTATAATAATTCATCAAGCCATATCGATAAAACTGTAATTTATGTTTTTTTGTTTGTTTTTT
TTGCATCCATAAGTGTATTTGCTTATAGATATACTAAATATTCACCTTGTGAAAATGTAACCTTTAATAT
CGATAAAGCCCAAAACACAGTTGGAGAACTAATAAAATTTAAGGATGTTACAGACACGGCAGAATCATGG
TATTGGGATTTTGGTGATAACTCCATAGCATCAACACAAAAAGAACCATTACACGTTTACAAAACACCAG
GAGATTACACAGTAAAACTAATAGTTAATGATATTTGTGAAGCAACACAAACCGTTTCTATAGCAGAGAA
AAAAGAAGTTTTAGACCCAACAAAGTTTCCAATATTCGAACTTCAAAAAACTATAAAAGTAGGTCAAAAA
CTAAGAGTAAATGACGAAACAGAAAACGCATCAACCTGGGAGTGGCGTTTTGGAGAAACAGCAAAAATAA
ACGCAAATACAAAACGTGCAAGTTATGTATATACAGAGCCAGGGTTAAAAACAGTATCTTTAGTAGTAAA
TGGAGATTTAAAATACGTAACTAAAAAAACAATCGAAGTTTTACCACTAGCAGAAACAAAAAGAAAACCT
ATAGATATACCACAAGCACCATCTAAACCAAGTGTAGATATTAAGTACAAACCAGAATCTGCAATTAAAG
ATAAACCATCTACACCAAAATTAGCCCCATATATAAGCGAAGCAGATTTTAAAGCAAAAATGATGAAAGT
CTCTAAAGAAGAAATGAGTGCAAAACAATTTTCAGAATATTTTTGTGGAGATATTAATAAAAAAATAGTT
GCTAATGGAAGAAATACAACATTTCTAGTATTCTGCGAAAAAATAAGCGACAAAAAAATAAGAATCAAAA
AGTTAGAAATTTTTAGAGATAAAGGATCAAATTGTATAAATACTATTACAATAGATTGTAGAATACGAGG
GCTTTTTAACGACTAG