SecReT6
Protein ID: 336173410
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2277
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2542389..2543543 [+]
Producthypothetical protein
NoteTssK
UniProt IDF6GGS0
KEGG IDlan:Lacal_2277
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.0057, Aligned region: 151..256
Protein Sequence: 384 a.a.     [Download]
>gi|336173410|ref|YP_004580548.1| hypothetical protein [Lacinutrix sp. 5H-3-7-4]
MKPQDKHRVNWIDGMKINKDHFIDFEESVIHAIKSSEQKQVTPVSYGLLPDFSEQGSAIDLLISIDGQNT
IEVILNKCHAITLGGFQINISEETKPLLEQSGYILKQQYAIGNEDNEFYVILTVNPYERIPVGNANPNEE
PPRHPYVLPEYKLDILTKAEVSKRELGLHHITIGKVIVKDNVPKLVENFIPPCKSIQSHADLKFTFNEIV
TFFNLMESYSMHVIQKIYQKKQSNDLSHMVLHICQRVLENLNRSIPEFRMQDKYESPIVMINKLSGLARV
IKSSLDVFVGTGKEELLNYLTDWCDLNQGAFENVLIDMLEIKYEHTDINASLLKVSSFSKLMLSLFKKLN
ELDYIGKKEDSNIFVKEEVVDNVEVKNRRSFLLD
 
Nucleotide Sequence: 1155 bp     [Download]
>gi|336171143|ref|NC_015638.1|:2542389-2543543 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGAAACCACAAGACAAACATAGAGTAAACTGGATAGATGGAATGAAAATTAATAAAGATCACTTTATTG
ATTTTGAAGAGTCTGTAATCCATGCAATAAAAAGTTCAGAACAAAAGCAAGTAACACCAGTAAGTTATGG
GTTACTTCCAGATTTTTCAGAACAAGGTAGCGCAATAGATTTGCTAATTTCTATAGATGGACAAAACACA
ATAGAAGTTATATTAAATAAATGTCATGCAATAACACTTGGAGGATTTCAAATTAATATATCTGAAGAAA
CCAAGCCGCTTTTAGAACAATCAGGATACATATTAAAGCAACAATATGCAATAGGAAATGAAGATAACGA
GTTTTATGTTATTTTAACCGTAAACCCATACGAGAGAATTCCAGTAGGAAATGCGAACCCAAACGAAGAG
CCACCAAGGCATCCATACGTATTACCAGAATACAAACTAGATATTTTAACAAAAGCAGAAGTCTCTAAAA
GAGAATTAGGTTTACATCATATAACAATAGGTAAAGTTATAGTAAAAGACAATGTACCTAAATTAGTAGA
AAACTTTATTCCACCTTGTAAATCAATTCAAAGTCATGCAGATTTAAAATTTACATTTAATGAGATTGTT
ACTTTTTTTAATTTAATGGAATCTTACTCCATGCATGTAATTCAAAAAATATATCAAAAAAAGCAATCTA
ACGATTTGTCACATATGGTATTACATATATGCCAGCGTGTTTTAGAAAATTTAAATCGTAGTATTCCAGA
ATTTAGAATGCAAGATAAATATGAATCTCCAATAGTGATGATTAATAAATTATCTGGATTAGCAAGAGTA
ATAAAAAGTAGCCTAGATGTATTTGTTGGTACAGGTAAAGAAGAGTTGCTAAATTATTTAACAGATTGGT
GTGATTTAAACCAAGGAGCCTTTGAAAACGTATTAATAGATATGCTAGAAATAAAATACGAACATACAGA
TATTAATGCATCGCTACTTAAAGTATCTTCATTCTCAAAGTTAATGTTATCCCTATTTAAAAAATTAAAC
GAGCTAGATTACATTGGTAAAAAAGAAGATTCAAATATTTTTGTAAAAGAAGAAGTAGTAGATAATGTAG
AAGTTAAAAACAGAAGAAGCTTTTTATTAGATTAA