SecReT6
Protein ID: 336173411
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2278
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2543561..2544064 [+]
Producthypothetical protein
NoteTssO
UniProt IDF6GGS1
KEGG IDlan:Lacal_2278
PDB IDNA
Domain hit(s) vs Pfam CCDC155 [PF14662], Evalue: 0.0072, Aligned region: 40..91
CCDC155 [PF14662], Evalue: 0.0072, Aligned region: 135..160
Protein Sequence: 167 a.a.     [Download]
>gi|336173411|ref|YP_004580549.1| hypothetical protein [Lacinutrix sp. 5H-3-7-4]
MKPKNSKERRSAFFKFLALFVITMLAILFAVYFNFKVPNQENTLLKAQVKSVEKEMEFQNNFSKEMSEIK
RMIDSLDVPGQNLPYQNSKISEKLVELQKTIPTKDSTFRYDMYSNIVATYVNLQQSEGELIDLNDAKSTI
EEYQTALEKCRNELKQAERDLYIARGR
 
Nucleotide Sequence: 504 bp     [Download]
>gi|336171143|ref|NC_015638.1|:2543561-2544064 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGAAACCAAAAAATAGTAAAGAAAGACGAAGTGCATTTTTTAAGTTTTTAGCACTTTTTGTAATAACTA
TGTTAGCCATACTATTTGCAGTATACTTTAATTTTAAAGTGCCAAACCAAGAAAACACCTTACTTAAAGC
TCAGGTAAAATCTGTAGAAAAAGAAATGGAGTTTCAAAATAACTTTTCTAAAGAAATGAGTGAAATAAAA
CGCATGATAGACTCTTTAGATGTACCAGGACAAAATTTACCATATCAAAACTCAAAAATAAGTGAAAAAT
TAGTAGAGTTACAAAAAACAATACCAACAAAAGACTCTACGTTTAGGTACGATATGTATAGTAATATTGT
AGCAACATATGTTAATTTACAACAATCTGAAGGCGAATTAATAGATTTAAACGATGCTAAAAGTACAATA
GAAGAATATCAAACAGCATTAGAAAAATGTAGAAACGAATTAAAACAAGCCGAACGCGACTTATATATCG
CCAGAGGAAGATAA