SecReT6
Protein ID: 336250342
SecReT6 ID447
T6SS typei3
Gene symbol-
Locus tagEAE_19330
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4139426..4141822 [-]
Producthypothetical protein
NoteTssI
UniProt IDG0E7R9
KEGG IDeae:EAE_19330
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-71, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 3.30E-25, Aligned region: 365..458
Protein Sequence: 798 a.a.     [Download]
>gi|336250342|ref|YP_004594052.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MSNRITVQLPVEGLLFWKLSGHEAMSEMFELSLTLLGSDARLDRSKLLGQPVTVTIPTQNALSSRYFNGK
ITRVAVSAVELSGIRYAAYQLIVEPDLWPMKRDRNLRIFQGQTVPQIINTLLSEYQVNVEDKLNGSYRVW
DYCVQYQESSFAFISRLMELEGIAYHFRHEAGKHTMVLTDSATQHQPVSGYETIPYHQTASGGITTEEGI
GQWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPASPSPGSIDVYDWPGRFVDHGHGEFYARIRQERWQ
VEHQQIQASATAVGIAPGATFTLTNAPFFSDNGEYLTTAADYLFEENSYASGGNSDISHQIHFRVIPSSV
VYRPAQVTDWPRTYGPQTAKVVGPEGESIWTDRYGRIKVKFHWDRHAKGDDTSSCWVRVSSAWAGQGFGG
VQIPRVGDEVVIDFINGDPDRPIVTGRVYNEASMPPWDLPGDATRMGFMTRSKDGNQDNASYLFFEDKLG
EESVDLHSEKNMNVSVEGMHNEVVHQQTIYSHLNTRSTSVVGHDTQTFNAGQTIAITANGRNESIVDSET
KSVTGYSSNSYTGNVVTESGDTVSTLAASKIMYETPDVIFGQVVDAKGTESAVPNIPFDIKNTAGQIMAA
PGTKLYATDYLAAASTSAVSAATRVTYKKGVVTHIQGIDKLTVDNNQIVDVKGNVARNILGELNETVQGK
ISINSPLKISIKSDTKVEIVSPEGLFTNKGISVSLNGTTHSFNGLSTSVNGASFSWTPLNMPTSLASIVH
SPMNVTRSLTKIESSLQNVVIGFIHMFM
 
Nucleotide Sequence: 2397 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4141822-4139426 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGTCTAACAGGATCACCGTTCAGCTCCCCGTTGAGGGGCTGCTTTTCTGGAAACTCAGCGGACATGAAG
CCATGTCGGAAATGTTCGAGCTCAGCTTAACGCTGCTTGGCAGCGATGCGCGTCTGGATCGCAGCAAGCT
GCTTGGCCAGCCGGTCACCGTGACCATTCCGACGCAAAACGCGCTGAGTTCGCGTTATTTCAACGGTAAA
ATTACCCGCGTGGCGGTGAGCGCCGTTGAACTGAGCGGTATCCGCTACGCCGCTTACCAACTGATCGTTG
AACCCGACTTATGGCCGATGAAACGCGACCGCAACCTGCGTATATTCCAGGGGCAGACGGTACCGCAGAT
CATCAATACGTTGCTGAGTGAATACCAGGTCAACGTTGAGGATAAGCTGAACGGCAGTTACCGCGTCTGG
GATTACTGCGTCCAGTATCAGGAAAGTAGTTTCGCCTTTATCAGCCGCCTGATGGAGCTGGAGGGGATTG
CCTACCATTTCCGTCACGAGGCGGGTAAACATACGATGGTTCTGACCGATTCAGCCACCCAGCATCAACC
GGTAAGCGGCTATGAAACCATTCCCTACCACCAGACGGCATCGGGCGGTATTACCACTGAAGAGGGGATC
GGTCAGTGGGCGCTGGAAGATAGCGTGACGCCGGGGATTTACAGCCTCGATGACTATGATTTCCGTAAAC
CTAACGCCTGGCTGTTTCAGGCGCGGCAGAACCCGGCATCGCCCTCGCCGGGCAGTATCGACGTGTACGA
CTGGCCGGGGCGGTTTGTCGATCACGGACACGGTGAATTCTACGCGCGTATCCGCCAGGAGCGCTGGCAG
GTTGAACATCAGCAGATCCAGGCGTCCGCCACCGCGGTAGGCATCGCTCCCGGCGCAACGTTTACCCTAA
CTAATGCGCCATTCTTTAGCGATAATGGCGAATATTTGACGACCGCCGCAGATTACTTGTTTGAAGAGAA
CAGCTACGCCAGCGGCGGCAATAGCGATATCTCGCACCAAATCCATTTTAGAGTGATCCCCTCTTCGGTA
GTCTATCGCCCGGCGCAGGTAACCGACTGGCCGCGAACCTATGGCCCGCAGACGGCGAAAGTTGTCGGGC
CTGAAGGGGAAAGCATCTGGACCGACAGGTATGGCCGCATCAAAGTGAAGTTTCACTGGGACCGCCATGC
CAAAGGCGATGACACCAGCTCCTGCTGGGTTCGCGTGTCGAGCGCCTGGGCAGGCCAGGGCTTTGGCGGC
GTGCAAATTCCCCGCGTCGGCGATGAAGTGGTCATTGATTTTATCAACGGCGATCCTGACCGCCCGATCG
TCACCGGACGTGTGTATAATGAAGCCAGCATGCCGCCATGGGATCTCCCCGGCGACGCCACCCGGATGGG
CTTTATGACGCGGAGTAAGGATGGGAATCAGGACAATGCCAGTTACCTGTTTTTTGAAGATAAGCTTGGT
GAAGAGTCCGTCGATTTGCATTCTGAAAAAAATATGAACGTGTCTGTTGAAGGGATGCACAATGAAGTTG
TTCATCAGCAAACGATCTATTCACATCTAAATACGCGTTCCACTAGTGTGGTAGGCCACGATACGCAAAC
CTTTAATGCCGGGCAAACCATCGCTATCACGGCTAATGGACGTAATGAAAGCATTGTCGATAGTGAAACA
AAATCGGTTACGGGTTATTCAAGTAATAGTTATACCGGCAATGTGGTAACCGAAAGCGGTGATACGGTTA
GCACTTTGGCGGCATCGAAGATAATGTACGAAACGCCAGATGTTATCTTTGGTCAGGTTGTCGATGCCAA
AGGTACAGAAAGTGCAGTTCCCAATATACCTTTTGATATTAAAAATACCGCTGGGCAGATTATGGCTGCA
CCAGGGACCAAGCTCTACGCAACAGATTATTTGGCAGCAGCCTCTACAAGCGCAGTTTCCGCTGCCACCA
GAGTGACATACAAAAAAGGGGTTGTAACGCATATCCAAGGTATTGACAAACTTACCGTGGATAATAATCA
AATAGTAGACGTTAAAGGGAATGTTGCTAGAAATATCCTGGGTGAACTTAATGAAACGGTTCAAGGCAAA
ATATCTATTAACTCACCATTAAAAATATCTATAAAAAGCGATACTAAAGTAGAAATTGTTTCCCCTGAGG
GGTTGTTCACTAACAAGGGAATAAGTGTATCATTAAATGGCACAACACACTCCTTCAACGGACTTAGCAC
ATCTGTGAATGGTGCATCGTTTAGTTGGACACCATTAAACATGCCAACGTCATTAGCAAGTATTGTCCAC
TCTCCAATGAATGTAACTAGATCTCTAACAAAAATAGAATCTTCATTGCAGAATGTAGTTATTGGTTTTA
TCCACATGTTTATGTAA