SecReT6
Protein ID: 336250346
SecReT6 ID447
T6SS typei3
Gene symbol-
Locus tagEAE_19350
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4144149..4146761 [-]
Productprotein clpV1
NoteTssH
UniProt IDG0E7S3
KEGG IDeae:EAE_19350
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-41, Aligned region: 220..244
AAA_2 [PF07724], Evalue: 1.10E-41, Aligned region: 601..766
AAA [PF00004], Evalue: 2.90E-21, Aligned region: 222..354
AAA [PF00004], Evalue: 2.90E-21, Aligned region: 607..691
ClpB_D2-small [PF10431], Evalue: 8.30E-16, Aligned region: 774..846
AAA_5 [PF07728], Evalue: 1.30E-14, Aligned region: 222..245
AAA_5 [PF07728], Evalue: 1.30E-14, Aligned region: 348..371
AAA_5 [PF07728], Evalue: 1.30E-14, Aligned region: 500..529
AAA_5 [PF07728], Evalue: 1.30E-14, Aligned region: 606..725
AAA_16 [PF13191], Evalue: 7.40E-11, Aligned region: 34..77
AAA_16 [PF13191], Evalue: 7.40E-11, Aligned region: 199..244
AAA_16 [PF13191], Evalue: 7.40E-11, Aligned region: 267..300
AAA_16 [PF13191], Evalue: 7.40E-11, Aligned region: 603..651
Sigma54_activat [PF00158], Evalue: 1.80E-07, Aligned region: 204..240
Sigma54_activat [PF00158], Evalue: 1.80E-07, Aligned region: 606..723
AAA_22 [PF13401], Evalue: 5.80E-07, Aligned region: 222..308
AAA_22 [PF13401], Evalue: 5.80E-07, Aligned region: 369..390
AAA_22 [PF13401], Evalue: 5.80E-07, Aligned region: 605..637
AAA_22 [PF13401], Evalue: 5.80E-07, Aligned region: 667..689
AAA_14 [PF13173], Evalue: 9.50E-07, Aligned region: 222..303
AAA_14 [PF13173], Evalue: 9.50E-07, Aligned region: 328..391
AAA_14 [PF13173], Evalue: 9.50E-07, Aligned region: 605..716
AAA_17 [PF13207], Evalue: 1.30E-06, Aligned region: 222..275
AAA_17 [PF13207], Evalue: 1.30E-06, Aligned region: 606..642
AAA_19 [PF13245], Evalue: 1.60E-06, Aligned region: 221..248
AAA_19 [PF13245], Evalue: 1.60E-06, Aligned region: 604..629
AAA_25 [PF13481], Evalue: 8.60E-06, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 8.60E-06, Aligned region: 275..319
AAA_25 [PF13481], Evalue: 8.60E-06, Aligned region: 597..631
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 222..249
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 279..323
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 473..502
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 607..639
AAA_18 [PF13238], Evalue: 2.30E-05, Aligned region: 222..245
AAA_18 [PF13238], Evalue: 2.30E-05, Aligned region: 608..635
Zeta_toxin [PF06414], Evalue: 2.60E-05, Aligned region: 221..245
Zeta_toxin [PF06414], Evalue: 2.60E-05, Aligned region: 600..656
IstB_IS21 [PF01695], Evalue: 5.00E-05, Aligned region: 208..241
IstB_IS21 [PF01695], Evalue: 5.00E-05, Aligned region: 606..635
IstB_IS21 [PF01695], Evalue: 5.00E-05, Aligned region: 717..738
Clp_N [PF02861], Evalue: 6.10E-05, Aligned region: 28..75
Clp_N [PF02861], Evalue: 6.10E-05, Aligned region: 116..123
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 200..240
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 275..306
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 353..396
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 605..645
AAA_29 [PF13555], Evalue: 0.00022, Aligned region: 214..238
AAA_29 [PF13555], Evalue: 0.00022, Aligned region: 604..631
RNA_helicase [PF00910], Evalue: 0.0004, Aligned region: 223..243
RNA_helicase [PF00910], Evalue: 0.0004, Aligned region: 607..628
RNA_helicase [PF00910], Evalue: 0.0004, Aligned region: 704..725
SRP54 [PF00448], Evalue: 0.0016, Aligned region: 221..242
SRP54 [PF00448], Evalue: 0.0016, Aligned region: 605..642
NTPase_1 [PF03266], Evalue: 0.0031, Aligned region: 222..244
NTPase_1 [PF03266], Evalue: 0.0031, Aligned region: 274..299
NTPase_1 [PF03266], Evalue: 0.0031, Aligned region: 606..629
DUF815 [PF05673], Evalue: 0.0035, Aligned region: 213..264
DUF815 [PF05673], Evalue: 0.0035, Aligned region: 605..647
UPF0079 [PF02367], Evalue: 0.0071, Aligned region: 222..242
UPF0079 [PF02367], Evalue: 0.0071, Aligned region: 602..634
Hpr_kinase_C [PF07475], Evalue: 0.0072, Aligned region: 222..235
Hpr_kinase_C [PF07475], Evalue: 0.0072, Aligned region: 604..624
AAA_30 [PF13604], Evalue: 0.0075, Aligned region: 208..244
AAA_30 [PF13604], Evalue: 0.0075, Aligned region: 605..637
T2SE [PF00437], Evalue: 0.009, Aligned region: 197..242
T2SE [PF00437], Evalue: 0.009, Aligned region: 603..683
Protein Sequence: 870 a.a.     [Download]
>gi|336250346|ref|YP_004594056.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQQDGDLQHIIRHFALDEQALTRD
IIAALDALPRGASSVSDLSEHIDSAVERAWVYGSLKYGVNRIRGGHLLIGLLKTWNLANVLKGISPQFSK
INVDALSESFETLLAASKESQQAAVEAANTSATPTAQGTLAQYGQNLTLRAQEGKIDPVVGRDEEIRQMV
DILMRRRQNNPLLTGEAGVGKTAVVEGLARRIAAGDVPQPLRNIELWLLDIGMLQAGAGMKGEFEARLQA
LINEVQSSPTPIVLFIDEIHTLIGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPALTR
RFQTVQVHEPDEEKALLMLRSTVSPLEKHHRVLLLDEAVNAAVKLSHRYIPARQLPDKAVALLDTACARV
AVSQSAPPPQLEDCLQRIAALDVELEIAQRENRVAIGDAQRIEQLKQARQQQETERDTLSRRWEQERALV
DEVIALRAQLQEADDDAEPALRQTLNEKQLALKTLQGEMPLLFAAVDENVVAAVVADWTGIPLGRMVKNE
IDAVLSLADTLNQRVIGQRHGLDLIAKRVRTSRARLDDPNKPVGVFMLCGPSGVGKTETALALAEALYGG
EQNVITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVFD
KGWMEDGEGRHIDFRNTIIILTSNVGTELISAMCADPDLMPEPEALSGALRQPLLQVFPPALLGRLLVVP
YYPLSDAMLGQIVRLQLARIQRRLQDNHNIVCEIDDSVVEQVVQRCTEVESGGRMVDAILTNTLLPQMSQ
ILLTANRNDEQFTQLRISYAQGEFHCQFAA
 
Nucleotide Sequence: 2613 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4146761-4144149 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGTCAGAAATCAGCCGTGCCGTACTCTTCGGCAAACTGGATACGCTGTTGTTTACCTCGCTGGAAAGCG
CAACCGCCTTTTGTAAACTGCGCGGCAACCCTTACGTTGAGCTGGTGCACTGGCTGCATCAGCTGATGCA
GCAGCAGGACGGCGATCTGCAACACATTATCCGCCATTTCGCCCTTGATGAGCAGGCGCTGACCCGCGAT
ATCATCGCGGCCCTGGATGCGCTGCCGCGCGGCGCCAGTTCGGTCTCCGACCTTTCTGAGCATATCGATA
GCGCCGTCGAACGCGCGTGGGTTTATGGCTCGCTGAAATATGGCGTCAACCGCATCCGCGGCGGCCATTT
GTTAATAGGGCTGCTGAAAACCTGGAATCTGGCTAACGTTCTGAAAGGCATTTCGCCGCAGTTTAGCAAA
ATCAATGTCGATGCCTTGAGCGAGAGCTTTGAGACGCTGCTGGCCGCCAGTAAAGAGAGCCAGCAGGCGG
CGGTGGAGGCGGCCAACACGAGCGCGACGCCGACGGCGCAGGGTACGCTGGCCCAGTACGGACAGAACCT
GACGCTGCGGGCGCAGGAGGGCAAAATCGATCCGGTGGTTGGCCGCGATGAAGAGATCCGCCAGATGGTG
GATATCCTGATGCGGCGCAGGCAGAACAACCCGCTGCTGACCGGGGAGGCTGGCGTCGGTAAAACCGCGG
TGGTGGAGGGGCTGGCGCGGCGGATCGCCGCAGGCGATGTCCCGCAGCCGTTGCGTAATATTGAGCTGTG
GCTGCTGGACATCGGCATGCTGCAGGCCGGTGCGGGCATGAAAGGCGAATTTGAAGCCCGTCTTCAGGCG
TTAATTAACGAAGTGCAATCCAGCCCGACGCCGATCGTGCTGTTTATCGACGAGATCCACACCCTGATTG
GCGCAGGCGGCCAGCAGGGCACCGGCGATGCGGCGAACCTGCTGAAACCGGCGCTGGCGCGCGGACAGTT
ACGCACCATCGGCGCGACCACCTGGGCGGAGTACAAAAAATATATTGAAAAAGATCCGGCGCTGACCCGC
CGTTTCCAGACGGTGCAAGTCCACGAGCCGGATGAAGAGAAAGCGTTGCTGATGCTGCGCAGTACTGTAT
CGCCGCTGGAGAAACACCATCGGGTGCTGCTGCTTGATGAAGCGGTTAACGCGGCGGTGAAGCTGTCGCA
TCGTTATATTCCCGCGCGGCAGTTGCCGGATAAAGCGGTCGCGTTGCTGGATACCGCCTGCGCCCGCGTC
GCCGTCAGCCAAAGCGCGCCGCCGCCGCAGTTGGAAGATTGCCTGCAGCGCATTGCCGCCCTGGATGTGG
AACTGGAGATTGCCCAACGCGAGAACCGGGTGGCGATTGGCGATGCTCAGCGCATTGAGCAACTCAAGCA
GGCGCGTCAGCAGCAGGAAACCGAACGCGATACCTTGAGTCGTCGCTGGGAGCAGGAACGCGCGTTGGTT
GATGAAGTCATCGCGTTGCGCGCGCAATTGCAGGAGGCTGATGACGACGCCGAGCCGGCGCTGCGCCAGA
CGCTTAATGAAAAACAGCTGGCGCTAAAAACCCTGCAGGGTGAGATGCCGCTGCTGTTCGCGGCGGTAGA
TGAGAACGTGGTGGCGGCGGTGGTCGCTGACTGGACCGGCATTCCGCTGGGGCGGATGGTCAAAAATGAA
ATTGACGCCGTACTGAGCCTGGCCGACACGCTCAACCAGCGAGTGATTGGCCAACGCCACGGGCTGGATC
TGATCGCCAAACGTGTTCGCACCTCACGCGCGCGGCTCGACGATCCCAATAAGCCGGTCGGCGTCTTTAT
GCTTTGCGGGCCATCCGGCGTGGGTAAGACCGAAACCGCGCTGGCGCTGGCGGAAGCGCTGTACGGCGGC
GAACAGAACGTTATCACCATCAACATGAGTGAGTTCCAGGAGGCGCATACCGTCTCGACCCTGAAGGGCG
CGCCACCGGGTTACGTGGGTTACGGCGAAGGCGGGGTGCTGACTGAAGCGGTACGACGCCGCCCGTATAG
CGTGGTGCTGCTGGATGAAATCGAGAAGGCGCATCCGGACGTGCACGAAATTTTCTTCCAGGTGTTTGAT
AAAGGCTGGATGGAAGACGGTGAAGGCCGCCATATCGATTTCCGCAATACAATCATTATCTTAACGTCTA
ACGTCGGTACCGAGCTGATTAGCGCTATGTGCGCCGATCCGGATCTGATGCCCGAGCCGGAAGCGCTGAG
CGGCGCGCTGCGTCAGCCGCTGTTACAGGTCTTCCCGCCAGCACTGCTTGGCCGCCTGTTGGTGGTGCCG
TACTACCCGCTGAGCGATGCGATGCTGGGGCAAATCGTGCGTCTGCAGCTGGCGCGTATTCAGCGCCGTC
TGCAGGACAATCACAACATTGTCTGCGAGATTGACGACAGCGTCGTCGAGCAGGTGGTTCAGCGTTGTAC
CGAAGTGGAATCCGGCGGGCGTATGGTCGATGCGATTCTGACCAACACGCTGCTGCCGCAGATGAGCCAA
ATTCTGTTAACCGCCAACCGTAACGATGAGCAGTTTACGCAACTGCGCATCAGCTATGCGCAAGGCGAGT
TTCATTGTCAATTTGCCGCGTAA