SecReT6
Protein ID: 336250347
SecReT6 ID447
T6SS typei3
Gene symbol-
Locus tagEAE_19355
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4146811..4147854 [-]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDG0E7S4
KEGG IDeae:EAE_19355
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-105, Aligned region: 24..328
Protein Sequence: 347 a.a.     [Download]
>gi|336250347|ref|YP_004594057.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MSDTLATIHRLTPLADVFWREVTAAPWRYDLFHLLRRIDAQGGERYPLGRAPLPKFESLRIGQTPSMGFA
PATLASAQKRANSAVHEISILSFGLFGPNGPLPVHMTEYARERIHHHQDDSLSAFADLFHHRLTLLFYRA
WADAQPTVSLDRADNRRFERYLASLIGMGQPGQLEKGDLSPHARFTHAGHLSRHGRDPEGLEKILRNYFK
VPVNIISNVPQWMPLTSREQAQLGAGRRLPRLGVSAFLGVAVRDVQHKFRLEIGPLSAAEYARFLPGENA
VNELRDWIRQYLGIEYAWDVRVLIRGDEIPGTVLSGDGKLGYSTWLGHQPAPAPRGDLVFSVEQSDA
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4147854-4146811 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGAGTGACACGTTGGCTACCATTCATCGCCTGACGCCGCTGGCGGACGTTTTCTGGCGCGAGGTTACCG
CCGCGCCCTGGCGCTACGACCTTTTTCATCTGCTGCGCCGCATTGACGCGCAAGGGGGCGAACGTTATCC
GCTTGGGCGCGCGCCGCTGCCGAAATTCGAATCGCTGCGCATCGGGCAAACGCCATCAATGGGGTTTGCC
CCCGCGACGCTGGCCAGCGCGCAAAAACGGGCAAATAGCGCGGTGCATGAGATATCGATTCTCAGCTTCG
GTCTGTTCGGCCCCAATGGCCCGCTGCCGGTTCATATGACCGAATACGCCCGCGAGCGTATTCATCATCA
TCAGGACGACAGCCTGAGCGCTTTTGCCGATCTCTTTCATCACCGCCTGACGCTGCTGTTCTACCGCGCC
TGGGCCGACGCGCAGCCAACGGTATCGTTAGACCGTGCGGACAACCGCCGCTTTGAGCGCTATCTCGCCT
CACTCATCGGCATGGGCCAGCCGGGGCAACTGGAGAAGGGCGACCTGAGCCCGCATGCGCGTTTCACCCA
CGCAGGCCATCTCAGCCGCCATGGTCGGGATCCGGAAGGGCTGGAGAAGATCCTGCGAAATTACTTCAAA
GTCCCGGTCAACATTATCAGCAACGTGCCGCAATGGATGCCGCTGACCTCGCGAGAACAAGCGCAACTGG
GGGCGGGAAGGCGTTTACCTCGCCTGGGCGTCTCGGCGTTTCTCGGCGTCGCGGTACGCGATGTTCAGCA
TAAATTCCGCCTTGAAATCGGCCCGCTTAGCGCCGCCGAATACGCCCGTTTTCTGCCGGGCGAAAACGCG
GTAAACGAATTACGCGACTGGATCCGCCAGTATCTTGGGATCGAATATGCATGGGATGTCAGGGTACTTA
TCCGCGGCGATGAAATACCCGGTACGGTCCTCAGCGGCGACGGCAAACTGGGTTACAGCACCTGGCTTGG
CCACCAGCCAGCCCCCGCGCCGCGTGGCGATTTAGTGTTTAGCGTGGAGCAGAGCGACGCTTGA