SecReT6
Protein ID: 336250348
SecReT6 ID447
T6SS typei3
Gene symbol-
Locus tagEAE_19360
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4147851..4149722 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDG0E895
KEGG IDeae:EAE_19360
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.40E-212, Aligned region: 5..623
Protein Sequence: 623 a.a.     [Download]
>gi|336250348|ref|YP_004594058.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MEGKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYVERMMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMIAPNYLAPTPSMAIAELQPDINKGDLSKGFVVPRGTMMDSQVLKKNGVTCSYTTAHDVTLLP
LRIEKAELGGIPADVPLAALGLSQRGAVSALRLRISCEGAQHLGHLTFDRLAFFLSGPDIEALRLLELIL
AHQVGVVCQTTGRDPLRFSLSEEAIQQEGFAANQALLPEDLRNFDGYRLLHEYFAFPARFRFISINGLSK
LIGQCKEEKSFDIIILLDKTDDRLEQVVEANHFALHCTPVINLFPKIAARQSLSDSQHEYHLVVDNIRPL
DYEIYSVSKIHGSADGHRDDREFRPFWSSWSKDAGDYGAYFSLRREQRVLSEHALRYGTRTGYTGSETFV
SLVDEQHAPWQEDLRYITAEVLCTSRDLPLMLQQELGQFVLADSLPVKTLKMRSGPTPPRPALAEGLSTW
RLISQLQMNYLSLMDGENGEGAAALRQLLGLYAGLAETAVARQIEGVRHCVLEPVHRRVPEPGPIVFARG
IGITLTVDERAFSGASPWLFGSVLERVFARLVSLNSFTEFTLCSQQRGEIGYWAPRMGKRALI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4149722-4147851 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGGAAGGCAAACTGCTTGAATATTACAACCGCGAGCTGGCCTATCTGCGTGAGATGGGCGCTGAATTCG
CCGAACGCTATCCGAAGGTTGCCGGCAGGTTGGGCATGCGCGGTATTGAGGTCGCCGATCCTTACGTTGA
GCGGATGATGGAGGGGTTCGCCTTTCTGACTTCCCGCGTGCAGCTAAAAATGGACGCCGAATTCCCGCGC
TTTTCACAACGTCTGCTGGAGATGATCGCGCCCAATTATCTGGCGCCTACGCCGTCGATGGCGATAGCCG
AACTGCAGCCGGACATCAATAAAGGCGATCTGAGTAAAGGTTTCGTGGTGCCGCGCGGTACGATGATGGA
CAGCCAGGTATTGAAGAAAAATGGCGTCACCTGTAGTTACACTACCGCGCACGATGTCACGCTGTTGCCG
CTGCGTATTGAGAAAGCCGAACTTGGCGGCATCCCCGCCGATGTGCCGCTGGCCGCGCTTGGGCTCAGCC
AGCGCGGCGCCGTCAGCGCTTTGCGCCTGCGTATAAGCTGTGAAGGGGCTCAACATCTTGGCCATCTGAC
CTTTGACCGGCTGGCGTTTTTCTTAAGCGGCCCGGATATTGAGGCGCTGCGCCTGCTGGAGCTGATTCTT
GCCCACCAGGTCGGGGTGGTGTGCCAGACCACCGGGCGCGATCCGCTACGTTTTTCGCTGAGCGAAGAGG
CTATCCAACAAGAGGGTTTCGCCGCCAATCAGGCGCTGCTACCGGAAGATCTTCGCAATTTTGACGGCTA
CCGGTTGCTGCACGAATACTTTGCCTTCCCGGCGCGCTTCCGCTTTATCAGTATTAACGGCCTCAGCAAG
TTAATTGGCCAGTGCAAGGAAGAAAAATCCTTCGATATCATTATTCTGCTGGATAAAACCGACGACCGGC
TGGAACAAGTGGTGGAAGCTAACCACTTCGCGTTGCACTGCACGCCGGTGATTAACCTGTTTCCGAAAAT
CGCCGCCCGCCAGTCGTTGAGCGACAGCCAACATGAATACCATCTGGTGGTCGATAACATCCGCCCGCTG
GACTACGAAATCTATTCGGTGAGTAAAATTCACGGCAGCGCTGATGGCCACCGCGACGATCGCGAGTTCC
GTCCATTCTGGAGTTCATGGAGCAAGGATGCCGGAGATTACGGCGCTTATTTTTCACTGCGCCGCGAACA
GCGGGTGCTTTCCGAACACGCGCTGCGCTATGGCACGCGTACCGGCTATACCGGCTCTGAGACCTTTGTC
TCACTGGTCGATGAGCAGCATGCGCCGTGGCAGGAAGATCTGCGTTACATCACCGCCGAGGTGCTGTGCA
CCAGCCGCGACCTACCGTTGATGCTACAACAGGAGCTGGGGCAATTCGTGCTGGCGGATTCGCTACCGGT
AAAAACATTGAAAATGCGTAGCGGCCCGACGCCGCCGCGACCGGCGCTGGCGGAAGGGCTCAGCACCTGG
CGGCTGATAAGCCAGCTGCAGATGAACTATCTCAGCCTGATGGACGGTGAAAATGGCGAAGGCGCAGCAG
CGCTGCGCCAGTTGCTTGGGCTGTATGCCGGGCTGGCGGAGACCGCCGTGGCCCGCCAAATCGAAGGGGT
ACGCCACTGCGTGCTGGAGCCAGTTCATCGCCGGGTGCCGGAGCCGGGGCCGATCGTCTTCGCCCGCGGT
ATCGGCATTACCTTGACCGTTGACGAGCGCGCTTTTTCCGGCGCCAGCCCGTGGCTGTTTGGCAGCGTAC
TGGAACGGGTCTTTGCCCGGCTGGTGTCGCTCAACAGCTTTACCGAATTCACCTTATGTAGCCAGCAGCG
CGGCGAAATCGGTTACTGGGCGCCGCGAATGGGGAAAAGGGCGCTGATATGA