SecReT6
Protein ID: 336250349
SecReT6 ID447
T6SS typei3
Gene symbol-
Locus tagEAE_19365
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4149725..4150288 [-]
Producttype VI secretion system protein ImpF
NoteTssE
UniProt IDG0E896
KEGG IDeae:EAE_19365
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.00E-19, Aligned region: 56..166
Protein Sequence: 187 a.a.     [Download]
>gi|336250349|ref|YP_004594059.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MNKPVRDGDALRSGWQARSKQETIGARDKMQPSLLDRLTDNQPQKKSEPLNSNLITHSTLRRHVLRDLQW
LFNTINHDDPQALAALAHVRRSVVNFGVAPLAGKRMSDIEWQDIQRKLTEAIISFEPRILPQGLQVRCIS
DTQSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 564 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4150288-4149725 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGAACAAACCGGTACGCGACGGTGACGCGCTGCGCAGCGGCTGGCAGGCGCGTAGCAAACAAGAGACCA
TTGGCGCCCGCGATAAGATGCAGCCGTCGCTGCTCGACCGCCTGACCGATAATCAGCCGCAGAAAAAATC
AGAGCCGCTTAACAGCAACCTGATCACCCACAGTACGCTGCGCCGTCACGTGCTGCGCGATCTGCAGTGG
CTGTTTAATACCATCAATCATGACGATCCGCAGGCGTTGGCCGCGCTGGCGCACGTGCGCCGTTCGGTGG
TTAATTTCGGCGTCGCGCCGCTGGCCGGGAAACGGATGTCGGATATTGAGTGGCAGGATATTCAGCGCAA
ACTTACCGAGGCGATTATCAGCTTCGAGCCGCGCATTCTGCCGCAGGGGCTGCAGGTCCGCTGTATTTCT
GATACCCAGTCACTGGATTTACATAACGTCCTGTCGATTGAAATCAAAGGGCGGCTGTGGTGCGTACCGT
ATCCATTAGAGTTTCTGTTCCGTACCGATGTGGATCTCGAAAATGGCCACTTTGAATTGAAAGACGCGGG
GTAA