SecReT6
Protein ID: 336250350
SecReT6 ID447
T6SS typei3
Gene symbol-
Locus tagEAE_19370
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4150285..4151079 [-]
Producttype VI secretion system protein ImpE
NoteTagJ
UniProt IDG0E897
KEGG IDeae:EAE_19370
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.80E-42, Aligned region: 141..263
TPR_19 [PF14559], Evalue: 0.0004, Aligned region: 13..68
TPR_19 [PF14559], Evalue: 0.0004, Aligned region: 215..225
Protein Sequence: 264 a.a.     [Download]
>gi|336250350|ref|YP_004594060.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MNTLYQQLAGESVGAALQRLESEIKSRPADADLRAAFVQFLCLSGNWTRALAQLKSWLALKPQAQPTVTL
LEQSIQGEQQRDAVFAGSARPQMPDSQWPWLSALASALCSDSETAQRQRLAAFEQAPLNPGNLNQTDTPA
VAFHWLMDGDARLGPVCELIVNGRYCWLPFAAIAEIRFQAPASVTDLVWRHALVRLTDGSEQVCQIPARY
PVTPQAEARFQLGRATEWQPLDDEGSLYQGHGQKVWLNDSDEFPILSLDVVSFA
 
Nucleotide Sequence: 795 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4151079-4150285 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGAACACGCTATATCAACAGCTGGCTGGCGAAAGCGTCGGCGCGGCGCTGCAACGCCTGGAAAGCGAGA
TCAAAAGCCGTCCCGCCGATGCCGATTTACGTGCGGCGTTCGTTCAGTTTCTATGCCTGAGCGGTAACTG
GACGCGCGCGTTGGCGCAGCTAAAAAGCTGGCTGGCGCTGAAGCCGCAGGCCCAGCCAACGGTCACCCTG
CTGGAACAGAGCATTCAGGGCGAGCAGCAGCGCGATGCGGTATTTGCCGGCAGCGCCCGCCCGCAGATGC
CGGACAGCCAGTGGCCGTGGCTGTCTGCGCTGGCCTCCGCGCTTTGTTCCGATTCAGAAACCGCCCAGCG
ACAGCGGCTGGCCGCCTTTGAACAGGCGCCCCTTAATCCTGGTAATCTCAATCAGACGGATACCCCCGCG
GTCGCTTTTCACTGGTTGATGGACGGCGACGCGCGTCTGGGCCCGGTTTGCGAACTTATCGTCAATGGCC
GGTATTGCTGGCTGCCGTTCGCCGCTATCGCCGAAATTCGTTTTCAGGCCCCGGCGAGCGTCACCGATCT
GGTGTGGCGCCACGCTCTGGTGCGCCTGACCGATGGAAGCGAGCAGGTGTGTCAGATCCCCGCGCGTTAC
CCTGTCACGCCGCAGGCGGAAGCCCGCTTCCAGTTGGGCCGCGCCACCGAGTGGCAGCCGCTGGACGACG
AAGGATCGCTCTATCAGGGCCACGGACAGAAAGTGTGGCTTAACGATAGCGATGAATTCCCGATTCTCTC
TCTCGACGTGGTGAGTTTTGCATGA