SecReT6
Protein ID: 336250353
SecReT6 ID447
T6SS typei3
Gene symbol-
Locus tagEAE_19385
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4152888..4154615 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDG0E8A0
KEGG IDeae:EAE_19385
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.60E-07, Aligned region: 27..94
UreE_N [PF02814], Evalue: 0.0015, Aligned region: 28..49
UreE_N [PF02814], Evalue: 0.0015, Aligned region: 78..99
Protein Sequence: 575 a.a.     [Download]
>gi|336250353|ref|YP_004594063.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MRFTIISTKAGHQPPQGSCDFYAPGGTIGRGTDNNLVLPDDDRAISRLQAIVHVAADGECKITNRGNVTR
VVLNEIPLERGRQVELQDGDILAIDDYRIEVSDLLQDSQPISRMAASGQPPVTAKPSTPAPSAAPTVAEA
APTAVPSEIWDSLMQEFSIADSISSSRAKPQADNAPNPFAEPKPAERNPEDPLAMFADSEPLFERPPVAT
DDLFADDTPFDRDSIFADVTPTTLVPPVEKPAQPVADEPQAELDPLALFGGDASAKTARHDDPLGLMGGA
PLTSVDAFSNEEPAKTVADEPDAAFDSPLLMAQPPQEPPAAAREEAPEITLPTPQAVARQAAQTPKGRLR
IDPVRHEHQATSTPQPGNGEVLQGELLEALLEGMGLGDMQPVPQFDKENMRQLGQMLSMFSQGTVALLSS
RSILKRGVKADMTMVLDDANNPFKLLPSGKTVLMQMFGARMPGFMPPKKSVRDALIDLQAHQLGMISGIR
AIIAAMLQSFNPEQLEEEAKRDGHTSRLALPASRKAALWDYFVRTYGETAGEIEDDFHTLFGEAFLYAYD
MEVNQYKDSQSGSEE
 
Nucleotide Sequence: 1728 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4154615-4152888 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGCGATTCACGATTATTTCGACCAAAGCCGGTCATCAGCCCCCGCAGGGCAGCTGTGACTTTTACGCGC
CGGGCGGTACCATTGGGCGCGGCACGGACAATAACCTGGTGCTGCCGGATGACGACCGCGCCATTTCTCG
CCTGCAGGCCATCGTTCACGTGGCGGCAGACGGCGAGTGCAAAATTACCAATCGCGGCAACGTGACGCGG
GTGGTACTCAACGAGATCCCGCTGGAGCGGGGGCGTCAGGTTGAACTCCAGGATGGCGATATCCTCGCTA
TTGACGACTATCGCATCGAAGTCAGCGATCTGTTGCAGGATAGCCAACCGATAAGCCGGATGGCGGCGAG
CGGTCAGCCGCCTGTCACAGCGAAACCGTCGACACCCGCGCCATCCGCAGCGCCCACCGTGGCGGAAGCC
GCGCCAACCGCGGTACCATCAGAAATCTGGGATAGCCTGATGCAGGAATTCTCGATTGCCGACAGCATCT
CCAGCAGCCGGGCTAAGCCGCAGGCCGATAATGCGCCTAATCCCTTCGCCGAGCCGAAGCCTGCCGAACG
TAATCCGGAAGATCCGCTGGCGATGTTCGCTGATAGTGAACCTCTGTTTGAGCGCCCGCCGGTGGCGACG
GACGACCTGTTTGCCGATGACACCCCATTTGATCGCGACAGTATTTTTGCCGACGTTACGCCAACGACGC
TGGTGCCACCAGTTGAAAAACCGGCTCAGCCTGTCGCCGATGAGCCGCAGGCAGAATTGGATCCGCTGGC
GCTCTTTGGCGGCGACGCTAGCGCCAAAACCGCGCGTCATGACGATCCGCTGGGGCTAATGGGCGGCGCG
CCGCTGACATCGGTAGATGCCTTCAGCAACGAAGAGCCTGCTAAAACGGTTGCCGACGAACCTGATGCCG
CTTTTGATTCGCCATTATTGATGGCCCAGCCGCCGCAGGAGCCGCCCGCGGCAGCGCGTGAAGAAGCGCC
GGAAATAACCTTACCGACGCCGCAGGCCGTGGCGCGGCAAGCCGCCCAGACGCCAAAAGGGCGCTTGCGT
ATCGATCCCGTACGTCATGAACATCAGGCGACCAGCACGCCGCAGCCGGGTAACGGCGAAGTGCTGCAGG
GAGAGCTACTGGAAGCCTTACTGGAAGGCATGGGGCTCGGCGATATGCAGCCGGTGCCGCAGTTCGACAA
AGAGAATATGCGGCAGCTTGGTCAAATGCTGAGCATGTTCTCGCAGGGAACCGTCGCGCTGCTCTCTTCG
CGTTCGATCCTCAAACGCGGCGTCAAAGCCGATATGACCATGGTACTGGACGACGCCAATAACCCGTTCA
AGCTGTTGCCTTCCGGGAAAACCGTGCTGATGCAGATGTTCGGCGCGCGGATGCCGGGCTTTATGCCGCC
GAAAAAATCGGTACGCGATGCGTTGATTGACCTGCAGGCCCATCAGTTAGGGATGATCTCGGGGATCCGC
GCCATTATTGCCGCGATGCTGCAGTCCTTTAATCCCGAGCAGCTGGAAGAAGAGGCTAAGCGCGATGGCC
ATACTTCGCGCCTGGCGCTTCCGGCCAGCCGCAAAGCGGCGTTATGGGACTATTTTGTCCGTACCTACGG
CGAAACCGCCGGGGAAATTGAAGACGATTTCCACACCCTGTTTGGCGAAGCGTTCCTCTATGCCTATGAC
ATGGAAGTGAATCAGTACAAAGACTCACAGAGCGGATCGGAAGAATAA