SecReT6
Protein ID: 336250358
SecReT6 ID447
T6SS typei3
Gene symbol-
Locus tagEAE_19410
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4158895..4159419 [-]
Producttype VI secretion system protein ImpB
NoteTssB
UniProt IDG0E8A5
KEGG IDeae:EAE_19410
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.70E-61, Aligned region: 11..165
Protein Sequence: 174 a.a.     [Download]
>gi|336250358|ref|YP_004594068.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MAISKSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKPVDNQPAVDERKFLDIDIDNF
DERMKALKPRVAFQVDNTLTNEGKLNVDLTFDSMDDFLPDAVARKVEPLNKLLEARTQLSNLLTYMDGKN
GAEELIAKILQDPTLLKSLSQMPKQDDSAKGSEE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4159419-4158895 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGGCAATAAGTAAAAGTGGGCAGAAATTTATCGCACGCAACCGTGCGCCCCGCGTACAGATCGAGTACG
ACGTAGAGATTTATGGTGCGGAACGCAAAATCCAGCTTCCGTTTGTAATGGGGGTAATGGCGGATCTGGT
GGGTAAACCGGTCGACAACCAACCCGCGGTCGATGAACGTAAGTTTCTCGACATCGATATTGATAACTTC
GACGAACGTATGAAAGCGCTGAAACCGCGCGTCGCTTTCCAGGTCGACAATACGCTGACCAACGAAGGCA
AACTGAACGTCGACTTAACCTTCGACAGCATGGACGACTTCCTGCCGGATGCCGTGGCCCGCAAAGTGGA
GCCGCTGAACAAACTGCTGGAAGCCCGCACCCAGCTTTCAAATCTGCTCACCTACATGGACGGCAAAAAC
GGCGCGGAAGAGCTGATTGCCAAAATTTTGCAGGATCCGACGCTGCTCAAATCGTTGAGCCAGATGCCGA
AACAAGATGACAGTGCGAAAGGTAGCGAGGAGTAA