SecReT6
Protein ID: 336250362
SecReT6 ID447
T6SS typei3
Gene symbol-
Locus tagEAE_19430
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4164855..4166084 [-]
Producthypothetical protein
NoteTssL
UniProt IDG0E8A9
KEGG IDeae:EAE_19430
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.70E-68, Aligned region: 17..222
DUF2077 [PF09850], Evalue: 3.70E-68, Aligned region: 349..386
OmpA [PF00691], Evalue: 1.00E-15, Aligned region: 287..385
Protein Sequence: 409 a.a.     [Download]
>gi|336250362|ref|YP_004594072.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MMQEQQADANHGVSGNNPLVTAANPLLNAIPQIRHSVSHDDQAGLRQRLIDEIRRFEVRGQQAGLPYEVI
VGARYCLCTALDEAAALTPWGSSGVWSGSGLLVTFHNETWGGEKFFQLLARLSQNPREHINLLELINYCL
LLGFEGRYRVMDNGRTQLETIKQRLWQMICGVRGGYAPPLSVHGEDRPVLRKLWRPVVPLWACVALAGFA
ACLFYIILNWRLGDATNPVLAKIYQTPLPEASIAQPAEKLPAVLNLRGFLRPEIAEGLVAVRDEADRSVV
ILKGDGLFASASTVVRDRYDPVIDRIAQAMNNVSGRILVVGYSDNVPIRSARFASNYELSLERARSVQKQ
LQNHLTQPERVKAEGRGEMNPIAPNTTPENRARNRRVEITLLVSPDNTRAELNGLPQGN
 
Nucleotide Sequence: 1230 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4166084-4164855 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGATGCAGGAACAACAGGCCGATGCCAACCATGGCGTGAGCGGCAATAATCCCCTGGTGACGGCCGCCA
ACCCATTACTTAATGCGATTCCCCAGATCCGTCATTCGGTATCGCACGATGACCAGGCCGGTTTGCGCCA
GCGTTTGATTGATGAAATCCGCCGTTTTGAAGTGCGCGGTCAGCAGGCGGGGTTACCCTACGAAGTAATA
GTCGGCGCCCGTTACTGCCTGTGTACCGCACTGGACGAGGCTGCGGCCTTGACGCCATGGGGGAGTAGCG
GCGTCTGGTCGGGCAGCGGTCTTTTAGTGACCTTTCACAATGAAACCTGGGGCGGGGAGAAGTTTTTCCA
GCTGCTTGCACGCCTGTCGCAGAATCCGCGCGAACATATCAATCTGTTGGAACTGATCAACTACTGCTTA
TTGCTCGGCTTTGAAGGGCGTTACCGGGTAATGGATAACGGCCGCACGCAGTTGGAAACTATCAAACAGC
GCCTGTGGCAGATGATTTGCGGCGTACGCGGCGGCTACGCGCCGCCGTTATCGGTTCACGGCGAGGATCG
CCCGGTGCTGCGTAAACTGTGGCGTCCGGTGGTGCCGCTGTGGGCCTGCGTCGCGCTGGCGGGGTTCGCC
GCCTGTCTGTTCTATATCATTCTTAACTGGCGGCTTGGCGATGCTACCAACCCGGTGTTGGCGAAAATTT
ACCAGACGCCGTTGCCGGAAGCGTCGATTGCTCAGCCGGCGGAAAAATTGCCGGCGGTACTTAACCTGCG
AGGTTTTCTGCGCCCGGAAATTGCCGAAGGGCTGGTTGCGGTCCGTGACGAAGCGGACCGCAGCGTGGTG
ATCCTCAAAGGCGACGGGCTCTTTGCTTCGGCCTCAACGGTGGTGCGCGATCGCTACGACCCGGTCATTG
ACCGTATTGCGCAAGCGATGAACAACGTCAGCGGCCGCATTCTGGTGGTCGGCTATAGCGATAACGTGCC
TATCCGCAGCGCGCGCTTTGCCTCGAACTACGAGCTGTCGCTGGAACGCGCGCGTTCGGTACAAAAACAA
CTGCAAAATCATCTAACGCAGCCCGAACGCGTAAAAGCCGAAGGGCGAGGGGAAATGAACCCCATCGCGC
CGAATACCACTCCTGAGAACCGTGCCCGTAACCGCCGTGTGGAAATTACTCTGCTGGTGTCGCCCGATAA
TACCCGGGCTGAGCTGAACGGATTGCCCCAAGGAAATTAA