SecReT6
Protein ID: 336250363
SecReT6 ID447
T6SS typei3
Gene symbol-
Locus tagEAE_19435
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4166099..4167442 [-]
Producttype VI secretion system protein ImpJ
NoteTssK
UniProt IDG0E8B0
KEGG IDeae:EAE_19435
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.90E-134, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|336250363|ref|YP_004594073.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MNKAEKVVWTEGMFLRPHHFQRAESYLQTQIREWGGLQRSWLWGFLEIELDDAMLRQGCIALSYASGLLP
DGTFFQFRDARQGPAPLQIPDNVTGEKVVLALPVRRGGREEVIFSEEKDSLARFTAFEQDVEDDNALSVG
DATVQFARPRLTLMLEKDLTAEWTAIGVAFIAEKRNDNAVKLDNGYIPPMLNGINHPLIYAMINDLHGLL
AQRSQQIGSRLRQPGRFNTSELIEFTLLALVNRHLGHLSHLKTLPLVHPESLWNSWLPFAAELTTWMAQR
GPDAALPIYDHDDLASCFGKLMLLLRQGLSQVMEDNAIQLPLIERSHGLNIATVPESSMVRDFGFVLAVK
ASVPGDVLQTHFPAQMKVAPVSKIRDLVQLQLPGLILRAMPAAPPQIPWHAGYNYFAVEKGGELWNDMEK
SGAFALHLAGEFPGLDMEFWAIRSPSE
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4167442-4166099 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGAATAAAGCAGAAAAGGTGGTCTGGACCGAAGGCATGTTTTTGCGTCCGCATCACTTTCAGCGGGCAG
AAAGCTACCTGCAAACGCAAATTCGCGAATGGGGCGGATTACAGCGCTCCTGGCTGTGGGGTTTTCTTGA
GATTGAACTTGATGATGCGATGCTGCGTCAGGGGTGCATAGCTCTGAGCTATGCCAGCGGCCTGCTGCCG
GATGGGACTTTCTTCCAGTTTCGCGATGCTCGTCAGGGCCCGGCGCCGTTGCAAATCCCGGATAACGTCA
CGGGCGAAAAAGTCGTATTGGCCTTGCCGGTACGCCGCGGCGGTCGGGAAGAGGTTATCTTCAGCGAGGA
AAAAGACTCGCTGGCGCGATTTACCGCGTTTGAACAGGATGTGGAAGATGACAATGCGCTGTCGGTCGGC
GATGCCACCGTGCAGTTTGCCCGCCCGCGGCTCACCCTGATGCTGGAAAAGGATTTGACCGCCGAGTGGA
CGGCCATCGGCGTGGCGTTCATCGCCGAAAAGCGCAACGATAACGCCGTAAAACTCGATAATGGCTATAT
CCCGCCGATGCTTAACGGCATCAATCATCCTTTGATTTACGCGATGATCAACGACTTGCATGGTCTGCTG
GCGCAGCGTAGCCAGCAAATCGGCAGCCGGCTACGACAGCCGGGGCGTTTTAATACTTCCGAATTAATTG
AGTTCACTCTACTTGCGCTGGTCAATCGCCATCTCGGCCATCTCTCACATCTCAAAACGCTGCCGTTAGT
TCATCCCGAGTCATTGTGGAATAGCTGGCTGCCGTTCGCCGCCGAGCTGACGACCTGGATGGCGCAGCGC
GGTCCGGATGCTGCGTTGCCGATTTATGACCATGACGATCTCGCGAGCTGCTTCGGCAAACTGATGCTGT
TGCTGCGCCAGGGGTTATCACAGGTAATGGAAGACAATGCCATCCAACTGCCGCTGATAGAACGATCGCA
TGGGTTGAACATCGCAACGGTACCCGAGAGCAGCATGGTGCGTGATTTCGGATTCGTATTGGCAGTTAAA
GCCAGCGTACCAGGTGATGTTCTGCAAACGCACTTCCCGGCGCAGATGAAAGTCGCGCCGGTGAGCAAAA
TTCGCGATCTGGTGCAACTACAGCTTCCGGGTTTAATTCTGCGCGCTATGCCCGCCGCGCCGCCGCAAAT
CCCGTGGCATGCCGGTTACAACTACTTTGCAGTCGAGAAGGGCGGCGAGCTGTGGAACGACATGGAGAAA
TCTGGCGCCTTCGCTCTGCATCTGGCAGGCGAGTTCCCCGGCCTGGATATGGAATTTTGGGCTATCCGTA
GCCCGTCGGAATAA