SecReT6
Protein ID: 336250364
SecReT6 ID447
T6SS typei3
Gene symbol-
Locus tagEAE_19440
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4167467..4167973 [-]
Producthypothetical protein
NoteTssJ
UniProt IDG0E8B1
KEGG IDeae:EAE_19440
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.20E-32, Aligned region: 20..150
Protein Sequence: 168 a.a.     [Download]
>gi|336250364|ref|YP_004594074.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MNNNSLLRQVMLAFYLFLFTLVSGCGSSSHSDPARYNLQFQAHPQINRSAPLKVRVLVLKSDAEFMSADF
YSLQNNAQKVLAGNLLNSDEFFLMPGQLAKKLSGQSSPEARYIGVMAEYQSLDGKKWRISLPLPTPGETP
FWQFWKLSADQLQANLYLDVNGIRVVQQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4167973-4167467 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGAATAATAACTCTCTTTTACGCCAGGTCATGCTGGCGTTTTATTTGTTTCTTTTTACGTTGGTTAGTG
GATGTGGTTCGTCTTCACACAGCGACCCTGCCCGATACAATCTTCAGTTCCAGGCCCACCCGCAAATTAA
CCGTTCTGCGCCATTAAAGGTCAGAGTGTTAGTGCTGAAATCCGATGCGGAATTCATGTCCGCCGATTTC
TACTCCTTACAAAATAACGCGCAAAAAGTTCTCGCCGGCAACTTGCTGAACAGCGATGAATTTTTCCTGA
TGCCGGGGCAACTGGCAAAAAAACTCAGCGGGCAAAGCTCGCCGGAGGCGCGTTATATCGGAGTGATGGC
GGAATACCAATCTCTGGATGGTAAAAAGTGGCGCATTTCTCTTCCTCTGCCAACGCCTGGCGAAACCCCT
TTCTGGCAGTTCTGGAAACTGTCGGCAGATCAACTGCAAGCCAATTTATATCTTGACGTTAACGGGATCC
GCGTCGTGCAGCAATAG