SecReT6
Protein ID: 336250612
SecReT6 ID448
T6SS typei2
Gene symbol-
Locus tagEAE_20680
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4432502..4433842 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDG0EAZ5
KEGG IDeae:EAE_20680
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 7.10E-48, Aligned region: 111..152
DUF3702 [PF12486], Evalue: 7.10E-48, Aligned region: 298..441
ImpA-rel_N [PF06812], Evalue: 6.10E-19, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 6.10E-19, Aligned region: 345..368
ImpA-rel_N [PF06812], Evalue: 6.10E-19, Aligned region: 425..441
Protein Sequence: 446 a.a.     [Download]
>gi|336250612|ref|YP_004594322.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MTTYPKRHLTTGGDPRTLADYAKLREEMHKLSHPARPDVDWLYAERLCLSLFDRNGVELQTAAWYTLART
QLTGLSGLNEGLAILETLITRQWGSLWPQPVHARMEILSGLGKRLQQALRTLTLTYADLSLIYEAEAHLK
ALDAALQRLELKHASQFDALLNLMHNAAVRLENSDGVTSADTLPHVVAMENASTHLDERVERTKWIYIAP
PETLPHVQAGNERQNSEKRWRPFVAGMLTMLALAAAAGWGWQAMAKPEPEQRQFALSLAPLPTVLSPDQL
RSFSQHAPPADDGIKQTRQQLSDLAQLKPNWAIDYSEQLVQQAQVLWPEQAKALSSQWRQQIIAAALPAE
NLTGWYQGMLQLQQLTQRLDALDEQKGKYMTVSELKSAVFAITQSFNRTVPAEEQLRQLSAMTEGQISRA
AQQQQAEQHLQQLIVSYALLKSKMAE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4433842-4432502 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGACAACATATCCTAAGCGTCACCTGACTACCGGCGGCGATCCGCGCACGCTGGCAGACTACGCAAAGC
TGCGTGAAGAAATGCATAAACTCAGCCACCCGGCGCGCCCCGACGTTGACTGGCTGTACGCAGAACGGCT
TTGTCTGTCGCTGTTTGACCGTAACGGCGTAGAGCTGCAGACTGCGGCCTGGTATACGCTTGCCCGTACG
CAGTTAACCGGTTTATCCGGGCTGAATGAAGGCCTGGCTATCCTGGAAACGCTGATTACCCGTCAGTGGG
GGAGCCTTTGGCCACAGCCGGTACACGCGCGGATGGAAATCCTCAGCGGTTTGGGTAAACGGCTACAGCA
AGCGCTGCGTACGCTGACGCTGACCTATGCCGATCTTAGTTTGATTTATGAGGCGGAAGCGCATCTGAAA
GCGCTGGATGCTGCGCTGCAGCGTCTGGAATTAAAGCATGCCAGTCAGTTTGATGCGTTGCTCAATTTGA
TGCATAACGCGGCGGTACGGCTGGAGAACAGCGATGGCGTAACTAGCGCTGATACCCTACCGCACGTAGT
CGCGATGGAGAATGCTTCCACCCATTTGGATGAGCGGGTTGAGCGAACGAAGTGGATTTATATTGCGCCG
CCGGAAACGCTGCCACACGTGCAAGCCGGCAATGAGCGTCAGAATTCTGAAAAACGATGGCGACCTTTTG
TGGCCGGTATGCTGACGATGCTGGCGCTGGCCGCAGCGGCGGGATGGGGGTGGCAGGCGATGGCTAAACC
AGAGCCGGAACAGCGGCAATTCGCTCTCAGTCTGGCGCCATTGCCGACGGTACTTTCGCCAGATCAGTTA
CGCTCCTTTTCTCAGCACGCACCGCCAGCAGACGATGGGATAAAGCAGACCCGGCAGCAGCTGTCAGATC
TGGCCCAACTCAAGCCGAATTGGGCCATCGACTATAGCGAGCAACTGGTACAACAGGCACAAGTGCTATG
GCCGGAGCAGGCGAAAGCATTGTCCTCGCAGTGGCGGCAGCAGATCATAGCCGCCGCGCTGCCGGCGGAA
AACCTCACCGGCTGGTATCAGGGAATGCTGCAACTGCAGCAATTAACTCAGCGTCTGGATGCCCTGGATG
AACAGAAGGGGAAATACATGACGGTTAGTGAACTCAAATCTGCGGTGTTCGCCATTACTCAGTCTTTTAA
TCGAACCGTCCCGGCTGAAGAACAGTTACGTCAACTATCAGCGATGACAGAAGGACAAATCAGCCGCGCT
GCGCAGCAACAACAGGCGGAACAACACCTGCAGCAGCTGATAGTCTCTTATGCGCTACTGAAAAGTAAAA
TGGCGGAATAG