SecReT6
Protein ID: 336250613
SecReT6 ID448
T6SS typei2
Gene symbol-
Locus tagEAE_20685
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4433863..4434306 [-]
Producthypothetical protein
NoteTssE
UniProt IDG0EAZ6
KEGG IDeae:EAE_20685
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-16, Aligned region: 26..113
Protein Sequence: 147 a.a.     [Download]
>gi|336250613|ref|YP_004594323.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MPRPSLYDTLFGNFSGGLDLHQIGEENQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTKILQGMPGSA
HQLMTTLSAVLLKYEPRLNSLRVEMLEQTQPGELRYAIDAELKEIGLVRYGTEFMPEGRVLLRHLKQQQY
LNARTAI
 
Nucleotide Sequence: 444 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4434306-4433863 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGCCACGCCCCTCACTTTACGACACCCTGTTTGGTAATTTCTCCGGCGGTCTCGATCTGCATCAGATCG
GTGAAGAAAATCAGGTCATTTTATCGGTGCTTGATAATATGCAGCGTATCCTCAACTGCCGGGCGGGTAC
GCTGGCGCATCTTCCGGATTACGGTCTGCCGGATATGACAAAAATTCTCCAGGGGATGCCGGGTAGCGCG
CACCAGTTAATGACCACGCTGTCCGCGGTACTGCTCAAATACGAACCGCGGCTGAACAGCCTCCGTGTGG
AGATGCTCGAACAGACACAGCCAGGCGAACTGCGTTATGCCATCGACGCGGAACTGAAGGAAATTGGTCT
GGTACGCTATGGCACGGAATTTATGCCTGAAGGCAGGGTTCTCCTTCGCCATCTGAAACAGCAACAGTAT
CTGAATGCCCGCACCGCTATTTAG