SecReT6
Protein ID: 336250614
SecReT6 ID448
T6SS typei2
Gene symbol-
Locus tagEAE_20690
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4434308..4435072 [-]
Producthypothetical protein
NoteTssJ
UniProt IDG0EAZ7
KEGG IDeae:EAE_20690
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-34, Aligned region: 95..245
Protein Sequence: 254 a.a.     [Download]
>gi|336250614|ref|YP_004594324.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MPWLGAHLDVRLQLYVARHLLPAAQRSCQPKNAARLGRTAVLRPLNAQYPATDIITIHLGRYQRVRKIFT
EGRTMKMATIAGKNCATLLPITLTAALTGCGLTQSVKDGAVSVTYAIFYKQIKTLHLDIRAREGVNHNAQ
GASLATVVRIYQLKERKAFDASDYPSLFADDSRAIPSDWLAQKDIRLRPGESVALDMPLETAAQYVAVAG
MFIAPDRVKDSWRLVLTRDDLDPDKPHIIEAGHNRLTLQPLKGN
 
Nucleotide Sequence: 765 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4435072-4434308 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGCCCTGGCTGGGCGCCCATTTGGATGTACGGCTACAGCTGTATGTGGCCCGCCATTTATTACCGGCTG
CGCAACGCTCTTGCCAACCCAAAAACGCGGCGCGGTTAGGGCGGACCGCGGTACTGCGCCCGCTTAACGC
GCAATACCCTGCTACTGACATTATCACCATTCATCTGGGGCGTTATCAGCGCGTCCGAAAAATATTCACC
GAAGGGAGAACGATGAAGATGGCAACTATCGCTGGTAAAAATTGCGCCACATTGCTGCCCATCACTCTCA
CTGCAGCCTTAACCGGCTGCGGCCTGACGCAGAGCGTAAAAGATGGAGCCGTCTCAGTGACCTACGCTAT
TTTTTATAAACAGATCAAAACGCTGCATTTGGATATTCGGGCCCGGGAAGGGGTGAACCACAATGCGCAA
GGGGCGTCATTGGCAACCGTAGTGCGAATTTACCAACTCAAAGAGCGCAAAGCGTTTGACGCCAGCGATT
ATCCCTCGCTATTTGCTGACGATAGCCGGGCAATACCAAGCGATTGGCTGGCCCAAAAAGATATCCGTCT
ACGCCCGGGGGAATCCGTGGCGCTGGATATGCCGCTGGAGACGGCGGCGCAATACGTCGCGGTGGCGGGG
ATGTTTATCGCGCCGGATCGGGTCAAGGACAGCTGGCGGTTAGTGTTGACCCGCGACGACCTCGACCCCG
ACAAGCCGCATATTATCGAAGCCGGTCACAACCGGCTGACGCTGCAACCGTTAAAAGGTAACTAA