SecReT6
Protein ID: 336250621
SecReT6 ID448
T6SS typei2
Gene symbol-
Locus tagEAE_20735
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4442155..4442469 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDG0EB04
KEGG IDeae:EAE_20735
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-29, Aligned region: 1..94
Protein Sequence: 104 a.a.     [Download]
>gi|336250621|ref|YP_004594331.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MLDLDKAGTPDPYVERLFEGVAFSMERLREKIDDDLPELTEGLVSMLWPHYLRTIPWLSVVALTPELPTM
KMAETVPAGLEIYSRPLGPKNTVCCAACAERGAA
 
Nucleotide Sequence: 315 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4442469-4442155 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGCTGGATCTCGACAAAGCCGGTACGCCGGATCCCTACGTAGAGCGTCTGTTTGAAGGGGTTGCTTTTT
CCATGGAGCGCTTGCGGGAAAAGATTGATGACGACCTGCCTGAGCTTACCGAAGGGCTGGTTAGCATGCT
GTGGCCGCACTATCTGCGCACCATTCCGTGGCTATCGGTGGTGGCGCTGACGCCGGAACTACCGACGATG
AAGATGGCGGAAACGGTGCCTGCCGGGCTGGAGATATATTCCCGCCCGCTGGGGCCGAAAAATACCGTCT
GCTGCGCCGCCTGCGCAGAGCGTGGGGCCGCGTGA