SecReT6
Protein ID: 336250622
SecReT6 ID448
T6SS typei2
Gene symbol-
Locus tagEAE_20740
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4442539..4444113 [-]
Producthypothetical protein
NoteTssA
UniProt IDG0EB05
KEGG IDeae:EAE_20740
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.60E-21, Aligned region: 67..127
ImpA-rel_N [PF06812], Evalue: 2.60E-21, Aligned region: 339..351
Protein Sequence: 524 a.a.     [Download]
>gi|336250622|ref|YP_004594332.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MASVHTLISASQVAPEALAAQTQQRLLLWENWLQPVTAEQPTGDDPGYDDDFQLMREEVNKLSGANTDLI
CQLAEKLLTTVTQDIRVASYYAWARLHRDGEAGLADGLELLAGLMQRFGVSLHPQRDRSRRAALDWLASQ
RMLDSLSLYPEVCNSDALRITGALLIMEQTQEGAVPGALCAALETRLMKSGGPEAVVPQNISDAPLAAVG
GSAPVLSGITSGQELLTQARVLAKYLSDQPDGWLSAHHLIKSIRHDTLHQLPPLLAGGRTRIDPPKPDQR
ALLKRLYLQQSWMELLEQASEMFSRGANHLWLDLQWYVHQALLKSGRDAQAAIIQHDLQGLLARLIGLEG
LAFNDGTPFADEVTLNWIQQQVLDNATIWLDDTASRAVTASGDDNILQLEPEALALVDSDGAEAALTWLQ
HRPGITTPRSRWLLRLLMARIAEQSGKNELAQHLLAELDVLAATLSLAQWEPELLFEVRARHLRLLRGKA
GRSETERARLQSQMDRLLADLIAIDPARAAVLCV
 
Nucleotide Sequence: 1575 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4444113-4442539 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGGCATCAGTTCATACATTGATTAGTGCGAGCCAGGTAGCGCCGGAAGCGCTGGCCGCACAGACCCAGC
AGCGTTTGCTGCTGTGGGAAAACTGGCTGCAGCCGGTCACGGCCGAGCAACCAACGGGCGATGATCCCGG
CTATGACGATGATTTCCAGTTGATGCGCGAAGAAGTGAATAAGCTATCCGGCGCCAATACCGATCTGATT
TGTCAGCTTGCGGAAAAGCTGCTGACCACCGTCACTCAGGATATCCGCGTCGCCTCATACTACGCCTGGG
CCCGCCTGCACCGCGATGGCGAAGCGGGTCTGGCTGATGGGCTGGAATTACTGGCTGGATTAATGCAGCG
TTTTGGCGTGAGTCTACACCCGCAGCGGGATCGCAGCAGGAGAGCTGCCCTTGACTGGCTGGCGAGCCAG
CGCATGCTCGACAGCCTGTCGTTATACCCGGAGGTATGCAACAGCGATGCGCTACGTATCACCGGCGCGT
TGCTGATCATGGAGCAGACGCAAGAAGGGGCGGTCCCCGGCGCGTTGTGCGCCGCCCTCGAAACCCGGTT
AATGAAATCCGGCGGGCCAGAAGCTGTGGTCCCGCAGAATATCAGCGATGCGCCGCTAGCGGCGGTGGGG
GGCAGCGCGCCAGTGCTCAGCGGTATCACCTCTGGTCAGGAGCTGCTGACGCAGGCGCGGGTGCTGGCAA
AGTATCTCAGCGACCAGCCGGATGGCTGGCTCTCTGCCCATCACCTGATAAAGAGCATTCGCCATGATAC
GCTGCATCAGTTGCCGCCGTTACTGGCGGGCGGCAGAACTCGTATTGATCCGCCAAAACCGGACCAGCGG
GCGCTGCTGAAAAGGCTGTATCTCCAACAGAGCTGGATGGAATTACTCGAGCAGGCCAGCGAGATGTTTT
CCCGCGGCGCAAACCATCTGTGGCTGGATCTGCAGTGGTATGTTCACCAGGCGCTGTTGAAATCCGGGCG
CGACGCGCAGGCCGCTATTATTCAGCATGATCTGCAAGGACTGCTGGCACGTTTGATCGGCCTGGAAGGG
TTGGCGTTTAACGATGGTACGCCGTTTGCCGATGAGGTGACGCTGAACTGGATACAGCAACAGGTGCTGG
ATAATGCAACCATCTGGCTGGACGACACCGCTTCCCGCGCCGTCACCGCTTCCGGCGACGACAACATCCT
TCAGTTAGAGCCGGAGGCGCTGGCTCTGGTCGACAGCGATGGCGCTGAGGCGGCGCTGACCTGGCTGCAA
CATCGTCCGGGTATCACCACCCCCAGAAGCCGCTGGTTACTGCGATTATTGATGGCGCGGATTGCCGAGC
AGAGCGGGAAAAACGAACTGGCGCAACATCTGCTGGCGGAACTGGACGTGCTGGCAGCCACGCTGTCACT
GGCGCAATGGGAACCGGAACTACTGTTTGAAGTCCGAGCGCGTCATCTGCGGCTGTTGCGCGGTAAGGCC
GGACGCAGCGAAACGGAAAGAGCTCGTCTGCAGTCGCAGATGGACCGTTTGCTGGCGGACCTGATTGCTA
TTGACCCCGCCCGCGCGGCGGTGCTGTGCGTTTAA