SecReT6
Protein ID: 336250623
SecReT6 ID448
T6SS typei2
Gene symbol-
Locus tagEAE_20745
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4444113..4444448 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDG0EB06
KEGG IDeae:EAE_20745
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-21, Aligned region: 14..102
Protein Sequence: 111 a.a.     [Download]
>gi|336250623|ref|YP_004594333.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MSATQPQEHNLHGWEYEFNLKQSYPKREQINQYRESDLAFIQRLLAEVGIFYYFTLQEEAQSEVVNFADA
QRALIFGKTLPVNSPSGMSDSGAESVWGCEAESEQRREDLY
 
Nucleotide Sequence: 336 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4444448-4444113 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
GTGAGCGCAACACAACCGCAGGAGCATAACCTGCATGGTTGGGAATATGAATTTAATCTCAAGCAAAGCT
ACCCAAAACGCGAACAGATAAACCAGTATCGCGAGAGCGACCTGGCGTTTATTCAGCGCCTGCTGGCTGA
AGTCGGCATATTCTATTATTTCACCCTGCAGGAAGAGGCGCAGAGCGAAGTGGTGAATTTCGCCGATGCG
CAGCGCGCGTTGATATTTGGTAAGACACTCCCCGTCAACAGCCCGTCGGGAATGAGCGACAGCGGGGCGG
AGTCCGTATGGGGCTGCGAGGCGGAGAGTGAACAGCGCAGGGAGGATCTTTATTAA