SecReT6
Protein ID: 336250624
SecReT6 ID448
T6SS typei2
Gene symbol-
Locus tagEAE_20750
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4444576..4447206 [-]
Producttype VI secretion ATPase, ClpV1 family protein
NoteTssH
UniProt IDG0EB07
KEGG IDeae:EAE_20750
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.10E-41, Aligned region: 233..252
AAA_2 [PF07724], Evalue: 3.10E-41, Aligned region: 607..772
AAA [PF00004], Evalue: 4.70E-21, Aligned region: 235..347
AAA [PF00004], Evalue: 4.70E-21, Aligned region: 450..500
AAA [PF00004], Evalue: 4.70E-21, Aligned region: 612..735
AAA_5 [PF07728], Evalue: 2.20E-14, Aligned region: 235..255
AAA_5 [PF07728], Evalue: 2.20E-14, Aligned region: 332..365
AAA_5 [PF07728], Evalue: 2.20E-14, Aligned region: 611..732
ClpB_D2-small [PF10431], Evalue: 8.50E-14, Aligned region: 778..850
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 61..91
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 212..256
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 280..313
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 475..508
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 595..647
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 675..705
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 753..806
AAA_22 [PF13401], Evalue: 1.50E-10, Aligned region: 234..320
AAA_22 [PF13401], Evalue: 1.50E-10, Aligned region: 608..653
AAA_25 [PF13481], Evalue: 7.40E-09, Aligned region: 235..309
AAA_25 [PF13481], Evalue: 7.40E-09, Aligned region: 606..640
AAA_19 [PF13245], Evalue: 2.00E-08, Aligned region: 232..257
AAA_19 [PF13245], Evalue: 2.00E-08, Aligned region: 607..639
Arch_ATPase [PF01637], Evalue: 1.60E-07, Aligned region: 66..96
Arch_ATPase [PF01637], Evalue: 1.60E-07, Aligned region: 213..250
Arch_ATPase [PF01637], Evalue: 1.60E-07, Aligned region: 287..385
Arch_ATPase [PF01637], Evalue: 1.60E-07, Aligned region: 605..654
IstB_IS21 [PF01695], Evalue: 1.40E-06, Aligned region: 229..294
IstB_IS21 [PF01695], Evalue: 1.40E-06, Aligned region: 611..631
Zeta_toxin [PF06414], Evalue: 2.10E-06, Aligned region: 229..259
Zeta_toxin [PF06414], Evalue: 2.10E-06, Aligned region: 606..651
AAA_17 [PF13207], Evalue: 3.60E-06, Aligned region: 235..300
AAA_17 [PF13207], Evalue: 3.60E-06, Aligned region: 610..647
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 235..263
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 611..634
Sigma54_activat [PF00158], Evalue: 4.00E-05, Aligned region: 218..249
Sigma54_activat [PF00158], Evalue: 4.00E-05, Aligned region: 611..728
AAA_14 [PF13173], Evalue: 4.40E-05, Aligned region: 235..331
AAA_14 [PF13173], Evalue: 4.40E-05, Aligned region: 609..693
Clp_N [PF02861], Evalue: 6.50E-05, Aligned region: 22..65
Clp_N [PF02861], Evalue: 6.50E-05, Aligned region: 111..122
AAA_33 [PF13671], Evalue: 0.00019, Aligned region: 235..252
AAA_33 [PF13671], Evalue: 0.00019, Aligned region: 610..646
AAA_18 [PF13238], Evalue: 0.00024, Aligned region: 235..257
AAA_18 [PF13238], Evalue: 0.00024, Aligned region: 612..641
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 236..257
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 612..633
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 709..730
TIP49 [PF06068], Evalue: 0.002, Aligned region: 235..256
TIP49 [PF06068], Evalue: 0.002, Aligned region: 285..314
TIP49 [PF06068], Evalue: 0.002, Aligned region: 578..633
ResIII [PF04851], Evalue: 0.0034, Aligned region: 220..256
ResIII [PF04851], Evalue: 0.0034, Aligned region: 306..317
ResIII [PF04851], Evalue: 0.0034, Aligned region: 583..634
AAA_10 [PF12846], Evalue: 0.0037, Aligned region: 234..257
AAA_10 [PF12846], Evalue: 0.0037, Aligned region: 301..323
AAA_10 [PF12846], Evalue: 0.0037, Aligned region: 611..870
T2SE [PF00437], Evalue: 0.0046, Aligned region: 218..254
T2SE [PF00437], Evalue: 0.0046, Aligned region: 607..689
AAA_29 [PF13555], Evalue: 0.0048, Aligned region: 229..251
AAA_29 [PF13555], Evalue: 0.0048, Aligned region: 607..622
AAA_28 [PF13521], Evalue: 0.007, Aligned region: 235..254
AAA_28 [PF13521], Evalue: 0.007, Aligned region: 611..631
Protein Sequence: 876 a.a.     [Download]
>gi|336250624|ref|YP_004594334.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MENPAILLRRLNPYCARALEGAASLCQARAHAQILPEHWLLKLLEQGEGDLTVLARRYEWDMDAIWQDLL
SFLETLPRSVHSRPQLSGSIQSLMQEAWLRASLAGETSLRSVHLLMALVSNPTRVRCDSLWPLLTLGQAQ
LEHLRPLLDMQSDERPELQPDEPGHAGDVEFVGRPVESAVKSAEMNPALQNALDKFTLDITARAREGKID
PVFGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDSLKPVSLRTLDLGLLQAG
AGVKGEFEQRLKNIIEAVQQSPVPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSE
YKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYAHHHGVHITDEAIRAAVTLSRRYLTGRQLPD
KAVDLLDTASARIRMGIDTVPELLTRMKAQITALEMEKQALLEDAMVGSGSDEARLAAIELEESRMILQL
DDLETQYGLELKLTEQLLSCRADPSRRKEIGELQSQLASVQNNHPLLGLDVDLRTVATVIADWTGVPLSP
LLKDEQTELLSLESNLDKRVVGQDMALNAIAQRLRATKTGLAPDNGPQGVFLLVGPSGTGKTETALALAD
ELFGGERSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVMNLF
YQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDRLMQMLKEHPEATESDLHDLLRPVLREHFQPALLARF
QTIIYRPLSQPAMRKIVNMKLNQVSQRLYRHYGMTTDIAEGLYDALTDACLLPDTGARNIDSLLNQQILP
VLSQQLLSHLAAGLKPQSLSLDVDEEGGVVMEFSHS
 
Nucleotide Sequence: 2631 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4447206-4444576 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGGAAAACCCAGCCATCCTGTTACGCCGTTTAAACCCTTACTGCGCCCGCGCCCTGGAAGGCGCCGCTT
CGCTGTGTCAGGCCCGCGCGCATGCGCAAATCCTTCCAGAACACTGGCTGCTAAAACTACTGGAGCAGGG
CGAGGGAGACCTGACCGTTTTAGCGCGGCGTTATGAGTGGGATATGGACGCTATCTGGCAGGATCTGCTC
TCTTTTCTGGAAACGCTTCCACGTTCGGTACACAGCCGGCCGCAGCTGTCCGGCAGCATCCAGAGCCTGA
TGCAGGAGGCGTGGCTGCGGGCTTCACTGGCGGGGGAGACCTCTCTACGCAGTGTTCATCTACTGATGGC
GTTAGTCAGCAACCCAACGCGGGTGCGCTGTGACAGTCTGTGGCCGCTGTTAACGTTGGGACAAGCGCAG
CTTGAACACCTGCGACCATTATTAGATATGCAGTCTGATGAGCGCCCGGAATTACAGCCAGATGAGCCTG
GCCACGCTGGCGATGTGGAGTTTGTCGGCCGCCCCGTGGAATCGGCCGTGAAGTCCGCTGAGATGAACCC
AGCATTACAGAACGCGCTGGATAAATTTACCCTTGATATCACTGCTCGTGCCCGTGAAGGCAAAATCGAC
CCGGTTTTTGGTCGCGATAACGAAATTCGTCAAATGGTGGATATCCTGTCGCGCAGAAGAAAAAACAACC
CAATCCTGGTTGGCGAACCCGGTGTCGGCAAAACCGCGCTGGTCGAAGGGCTGGCGTTGCGTATCGCGGA
GGGCAACGTGCCGGACAGTCTGAAGCCGGTTTCATTGCGTACGTTGGATCTCGGCTTACTGCAGGCCGGC
GCAGGCGTCAAAGGGGAATTCGAACAGCGGCTTAAGAACATTATCGAAGCGGTACAGCAGTCGCCTGTCC
CGGTGCTGCTGTTTATCGATGAAGCTCATACTATCATCGGCGCAGGCAACCAGGCCGGTGGCGCGGATGC
CGCTAATTTGCTCAAACCGGCCCTGGCGCGCGGCGAACTGCGAACTATCGCCGCCACGACCTGGAGTGAG
TATAAGCAGTACTTCGAGCGTGATGCCGCGCTGGAGCGCCGCTTCCAGATGGTCAAAGTCGACGAACCGG
ACGATGACACCGCCTGTCTGATGCTGCGCGGGCTGAAATCTCGCTATGCTCATCATCACGGGGTACATAT
CACCGATGAAGCCATTCGCGCCGCCGTGACACTTTCCCGACGCTATCTCACCGGTCGCCAGTTGCCAGAT
AAAGCGGTGGACCTACTGGATACCGCATCGGCCCGCATTCGCATGGGAATCGATACGGTGCCGGAATTGT
TGACGCGTATGAAAGCGCAAATCACGGCGCTGGAAATGGAAAAACAGGCGCTACTGGAAGATGCCATGGT
CGGTAGCGGTAGCGACGAAGCGCGGCTGGCGGCAATTGAGCTGGAAGAATCGCGTATGATTTTACAGCTT
GATGACCTGGAAACGCAGTACGGCCTGGAACTTAAGCTGACCGAGCAACTGCTGAGCTGCCGAGCCGATC
CTTCCCGCCGCAAGGAGATCGGTGAATTACAGAGCCAACTTGCCAGCGTCCAGAATAACCATCCGCTGCT
GGGGCTGGATGTCGATTTACGTACCGTAGCAACGGTGATTGCCGACTGGACCGGGGTACCGCTCTCTCCA
TTGCTGAAGGACGAGCAGACGGAACTGCTGAGTCTCGAATCTAATCTGGATAAACGAGTGGTGGGGCAGG
ATATGGCGCTAAACGCCATTGCCCAGAGACTGCGGGCGACCAAAACCGGGCTTGCACCGGATAACGGCCC
GCAGGGCGTATTTCTGCTTGTCGGTCCGAGCGGTACTGGAAAAACGGAAACCGCGCTGGCGCTGGCTGAT
GAACTGTTCGGTGGTGAAAGATCGCTGATTACCATCAATCTTTCCGAATATCAGGAGCCGCATACGGTGT
CCCAACTGAAAGGATCGCCTCCCGGTTATGTCGGCTACGGTCAGGGGGGGATTCTCACCGAAGCGGTACG
CAAACGTCCGTACAGCGTGGTCCTGCTTGATGAAGTGGAAAAAGCGCATCGCGATGTGATGAATTTATTC
TACCAGGTGTTCGACCGTGGCTTTATGCGCGATGGCGAAGGACGCGAAATCGACTTCCGTAATACGGTGA
TCCTGATGACCTCAAACCTCGGCAGCGATCGGCTGATGCAGATGCTGAAGGAACATCCGGAAGCGACAGA
ATCCGATTTACATGACCTGTTGCGGCCGGTGCTGCGAGAACATTTTCAACCAGCGCTGCTCGCGCGTTTC
CAGACCATTATTTACCGGCCGCTCAGCCAGCCGGCGATGCGCAAAATTGTCAACATGAAACTCAACCAGG
TCAGCCAGCGTTTGTATCGTCATTACGGTATGACAACCGATATTGCCGAAGGCCTGTACGATGCGTTGAC
GGACGCCTGCCTGCTGCCGGATACCGGCGCGCGTAACATTGACAGCCTGCTTAATCAACAAATTCTACCA
GTGCTGAGTCAGCAACTGTTGAGCCATCTGGCGGCAGGGCTGAAGCCGCAGAGCCTTTCTCTGGATGTCG
ATGAAGAAGGCGGCGTGGTCATGGAATTTAGCCACTCCTGA