SecReT6
Protein ID: 336250626
SecReT6 ID448
T6SS typei2
Gene symbol-
Locus tagEAE_20760
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4447984..4449519 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDG0EB09
KEGG IDeae:EAE_20760
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.60E-174, Aligned region: 85..507
Protein Sequence: 511 a.a.     [Download]
>gi|336250626|ref|YP_004594336.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MSVNTETNPAQGQTAVMNKESVYASLFEKINLSPASSLGDINVFLDDAALSEATAGERLTAAMQVFMDCI
RQSGQQVEKLDKTLIDHHIAELDFRISRQLDAVMHHPEFQKVESLWRGLKQLVDNTDYRQNVKTEILDVS
KDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDMALLRNISKVSAAAHMPFI
GAVGPKFFLKDSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYIGLVMPRVLGRLPYGPDTVPVRSFN
YIEQVKGPDHEKYLWTSASFAFASNMVRSFIQNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPSEV
MIPETREFEFANLGFIPLSYYKNRDYACFFSANSTQKPALYDTADATANSRINARLPYIFLLSRIAHYLK
LIQRENIGTTKDRRLLELELNTWVRGLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKLYAVPH
FQVEGMDVNLSLVSQMPKAKG
 
Nucleotide Sequence: 1536 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4449519-4447984 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGTCTGTAAATACTGAAACGAACCCCGCGCAGGGGCAAACCGCCGTAATGAACAAAGAAAGCGTTTACG
CTTCTCTGTTTGAAAAAATCAATCTGAGCCCGGCATCAAGCCTTGGCGATATTAATGTCTTTCTGGACGA
TGCGGCGCTATCAGAGGCCACGGCGGGGGAACGCCTGACCGCGGCGATGCAGGTTTTTATGGACTGCATT
CGTCAATCCGGTCAGCAGGTGGAGAAACTCGATAAAACGCTTATTGACCACCACATCGCGGAGCTGGATT
TCCGTATAAGCCGTCAACTCGATGCTGTTATGCATCACCCGGAGTTCCAGAAGGTAGAATCTCTGTGGCG
CGGCCTGAAGCAACTGGTAGATAACACCGACTATCGCCAGAACGTGAAAACCGAAATCCTCGATGTGTCC
AAAGACGATTTACGTCAGGATTTTGAAGATGCGCCAGAGCTGATACAGAGCGGCCTGTACTGGCATACTT
ACACCGCCGAATACGACACCCCCGGCGGCGAGCCGATAGGCTCGGTAATTTCAGCGTACGAGTTTGACGC
CAGCCCGCAGGACATGGCGCTGTTGCGTAATATTTCGAAAGTCTCCGCTGCGGCGCATATGCCATTTATC
GGCGCCGTAGGGCCGAAATTTTTCCTCAAGGATTCAATGGAAGAAGTCGCGGCGATTAAAGATATCGGCA
ACTATTTCGATCGCGCTGAGTACATTAAATGGAAATCGTTCCGCGATACCGATGACTCGCGCTATATCGG
CCTGGTCATGCCGCGGGTATTGGGCCGTCTGCCGTATGGGCCGGACACGGTTCCGGTGCGCAGCTTTAAC
TACATTGAGCAGGTAAAGGGGCCGGATCACGAAAAGTATCTGTGGACCAGCGCGTCATTCGCCTTCGCCT
CGAACATGGTACGCAGCTTTATTCAAAACGGCTGGTGCGTGCAAATCCGCGGCCCGCAGGCGGGCGGCGC
GGTGAAAGATCTTCCCATTCACCTCTATGATCTCGGCACCGGAAATCAGGTGAAAATCCCTTCCGAGGTG
ATGATCCCGGAAACCCGTGAGTTCGAATTCGCCAATCTGGGCTTTATTCCGCTGTCTTATTATAAAAACC
GTGACTACGCCTGCTTCTTCTCGGCTAACTCAACTCAGAAACCCGCGCTGTACGACACCGCGGATGCGAC
AGCCAATAGCCGTATCAACGCCCGCCTGCCGTACATCTTCCTGCTGTCGCGCATCGCCCACTACCTGAAA
CTGATCCAACGCGAGAACATCGGCACCACCAAAGATCGTCGCCTGCTTGAGCTGGAGCTCAATACCTGGG
TTCGTGGCCTGGTTACGGAAATGACCGATCCGGGTGACGAGCTGCAGGCCTCACATCCGCTGCGTGATGC
GAAAGTGGTAGTGGAAGATATCGAGGATAATCCAGGCTTCTTCCGCGTCAAGCTGTACGCGGTGCCGCAC
TTCCAGGTGGAAGGCATGGACGTCAATTTGTCTCTGGTTAGCCAGATGCCGAAGGCGAAAGGGTAA