SecReT6
Protein ID: 336250627
SecReT6 ID448
T6SS typei2
Gene symbol-
Locus tagEAE_20765
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4449562..4450053 [-]
Producttype VI secretion system protein ImpB
NoteTssB
UniProt IDG0EB10
KEGG IDeae:EAE_20765
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-52, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|336250627|ref|YP_004594337.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MADSFQNEVPKARINLKLSLHTGGAQKKVELPLKLLTVGDFSNGKEHRPLAERQKIDINKNNFNSVLSEF
NPEINLTVENTLAGDNSEDNVKLRFSDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
ERILKDPALSSELRAEMSALAGK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4450053-4449562 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGGCTGATTCATTCCAGAATGAGGTGCCGAAGGCACGTATTAATTTAAAATTATCCTTACATACCGGGG
GGGCGCAGAAGAAGGTTGAACTACCGCTTAAATTGCTCACCGTTGGTGATTTCAGTAATGGAAAAGAGCA
TCGACCATTGGCCGAGCGCCAGAAAATAGATATCAATAAGAATAATTTTAATAGCGTACTTTCTGAATTT
AACCCAGAGATCAATCTCACCGTTGAGAATACGCTGGCAGGTGATAACTCAGAAGACAATGTTAAACTGC
GTTTTTCCGATATAAAAGACTTTGAGCCCGAACAGGTTGCCCGGCAAATCCCTCAACTCCGCGCCATGCT
GGCGATGCGTAATTTATTACGCGATCTCAAATCGAACCTGCTAGATAACGCTACTTTCAGAAAAGAGCTT
GAGAGAATCCTTAAAGATCCAGCTCTGTCCAGCGAATTACGCGCCGAAATGAGTGCCCTTGCCGGGAAGT
AA