SecReT6
Protein ID: 337755026
SecReT6 ID479
T6SS typeii
Gene symbol-
Locus tagF7308_1010
StrainFrancisella sp. TX077308
Repliconchromosome [GenBank: NC_015696] [Browse all T6SS(s) in this replicon]
Location [Strand]1039091..1039276 [-]
Producthypothetical protein
NoteIglG
UniProt IDF8GC20
KEGG IDfrt:F7308_1010
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 7.00E-06, Aligned region: 10..55
Protein Sequence: 61 a.a.     [Download]
>gi|337755026|ref|YP_004647537.1| hypothetical protein F7308_1010 [Francisella sp. TX077308]
MNPFVFPWVCIPNLTPFIPTNPTTLLEGAPINTMNNKAICTFAAGGMVNFISSGQINAKTS
 
Nucleotide Sequence: 186 bp     [Download]
>gi|337754017|ref|NC_015696.1|:c1039276-1039091 Francisella sp. TX077308 chromosome, complete genome
ATGAACCCTTTCGTTTTTCCTTGGGTATGTATACCGAACCTTACACCATTTATACCAACGAACCCAACCA
CGCTATTAGAAGGTGCCCCAATAAATACTATGAATAACAAAGCAATATGTACATTTGCTGCTGGAGGTAT
GGTGAACTTCATAAGTAGTGGGCAGATTAATGCAAAAACATCTTAA