SecReT6
Protein ID: 338536017
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_31960
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7854974..7857238 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDF8C9J4
KEGG IDmfu:LILAB_31960
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-79, Aligned region: 34..335
Phage_base_V [PF04717], Evalue: 2.60E-26, Aligned region: 377..470
Gp5_C [PF06715], Evalue: 5.90E-18, Aligned region: 516..530
Gp5_C [PF06715], Evalue: 5.90E-18, Aligned region: 520..538
Gp5_C [PF06715], Evalue: 5.90E-18, Aligned region: 536..557
Gp5_C [PF06715], Evalue: 5.90E-18, Aligned region: 559..581
Gp5_C [PF06715], Evalue: 5.90E-18, Aligned region: 583..605
Gp5_C [PF06715], Evalue: 5.90E-18, Aligned region: 619..638
Gp5_C [PF06715], Evalue: 5.90E-18, Aligned region: 650..670
Gp5_C [PF06715], Evalue: 5.90E-18, Aligned region: 673..680
Gp5_C [PF06715], Evalue: 5.90E-18, Aligned region: 717..726
Protein Sequence: 754 a.a.     [Download]
>gi|338536017|ref|YP_004669351.1| unnamed protein product [Myxococcus fulvus HW-1]
MIANAALQANQAEFEFQAGAFTAGELAVLGFEAEETLSQPYAVEVALAARPDVDVDEKALLGQDARLTIM
LGDGTARFFHGIVSRMSRWDEGSGPERRRYRATVVPRLWTLRHRRKSRIYQELTVPDIVHKVLDEAKVEH
RLALTGTYPKRDYCVQYRESDLDFVARLLEEEGIFYFFEHGEDAHMMVLGDGASANPAMQGEPKLVFRER
SQMVASQEYVHELVSRTEVQPGAVALRDYNFLRPAQDLGASSEAEGAEAALEIYDYPGRYEEPAPGRNLA
KVRLEELRARAETVTGASYSRRVCVGHSFELAEHPDEAANRKYLPVSVRHLGHQSEALSIEQGSLRSRED
YRNEFLCQPAEVPFRPPRVTPRPVIPGAQTAIVVGPSGEEIHTDEHGRIKVQFHWDREGKSNDKSSCWIR
VSQAWAGPGWGALYLPRIGHEVVVEFLEGDPDRPIVTGSVYNGANPTPIDLPGNKTQSTLRSSSSPGGAG
SNELRFEDAAGSELVYLHAQKDFNIVVENDKTQEVRGNETLLVRKDRSRVIEGNQALLVKKNDDSTVTGN
QTLAVTQNRSTTVGGNHTEAVAGDQSISVSGNQALTVAMASAETVALGKMLNVGGALAVTVGAAFNELVG
GLKSEQVGGAKVEVVGAKKSETVKGARTLQVGGDLSEEVGKSRTLKVDKDMLVSVAGKVNHAAKDAYTLS
AKEISLVAQEQFTLKVGSATLQVKKNGDVVIKGAKVEVTATGDIVIKGSKISEN
 
Nucleotide Sequence: 2265 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7854974-7857238 Myxococcus fulvus HW-1 chromosome, complete genome
ATGATCGCGAACGCCGCCTTGCAAGCCAACCAGGCTGAGTTCGAGTTCCAGGCAGGGGCTTTCACAGCCG
GAGAGCTGGCCGTGCTGGGCTTCGAGGCCGAGGAGACGCTGTCCCAGCCCTACGCGGTGGAGGTGGCGCT
GGCGGCGCGGCCGGACGTGGACGTGGATGAGAAGGCGCTGCTGGGCCAGGACGCGCGCCTCACCATCATG
CTCGGGGACGGCACCGCGCGCTTCTTCCACGGCATCGTGTCGCGCATGTCACGCTGGGATGAAGGCAGCG
GCCCGGAGCGCCGCCGCTACCGCGCCACCGTGGTGCCGCGGCTGTGGACGCTGCGCCACCGGCGCAAGAG
CCGCATCTACCAGGAGCTGACCGTCCCGGACATCGTCCACAAGGTGCTGGACGAGGCCAAGGTGGAGCAC
CGGCTGGCGCTCACCGGCACCTACCCCAAGCGGGACTACTGCGTGCAGTACCGCGAGTCCGACCTCGACT
TCGTGGCCCGCCTCCTGGAAGAAGAAGGCATCTTCTACTTCTTCGAGCACGGCGAGGACGCCCACATGAT
GGTGCTGGGCGACGGCGCCTCCGCCAACCCCGCGATGCAGGGCGAGCCCAAGCTCGTCTTCCGCGAGCGC
AGCCAGATGGTCGCCTCGCAGGAGTACGTCCACGAACTGGTGTCCCGCACGGAGGTGCAGCCCGGCGCCG
TGGCCCTGCGCGACTACAACTTCCTGCGCCCCGCCCAGGACCTGGGGGCCTCTTCCGAGGCGGAGGGCGC
CGAGGCCGCGCTCGAAATCTACGACTACCCCGGCCGCTACGAGGAGCCCGCGCCGGGCCGCAACCTGGCC
AAGGTGCGCCTGGAGGAGCTGCGCGCCCGGGCGGAGACGGTGACGGGCGCCAGCTACAGCCGCCGCGTCT
GCGTGGGCCACTCCTTCGAGCTGGCGGAGCACCCGGACGAGGCCGCCAACCGCAAGTACCTGCCCGTCTC
CGTGCGGCACCTGGGCCACCAGTCGGAGGCGCTGAGCATCGAGCAGGGCTCGCTGCGCAGCCGCGAGGAC
TACCGCAACGAGTTCCTCTGCCAGCCCGCGGAGGTCCCCTTCCGCCCGCCGCGCGTGACGCCCCGCCCCG
TGATTCCCGGCGCGCAGACGGCCATCGTGGTGGGCCCCAGCGGCGAGGAGATCCACACCGACGAGCACGG
CCGCATCAAGGTCCAGTTCCACTGGGACCGCGAGGGCAAGAGCAACGACAAGAGCTCCTGCTGGATTCGC
GTCAGCCAGGCCTGGGCGGGCCCGGGCTGGGGCGCGCTGTACCTGCCGCGCATCGGCCACGAGGTCGTCG
TCGAGTTCCTCGAGGGAGATCCGGACCGGCCCATCGTCACCGGCAGCGTCTACAACGGCGCGAACCCGAC
GCCCATCGACCTGCCCGGCAACAAGACGCAGAGCACGCTGCGCTCCAGCTCCAGCCCCGGCGGCGCGGGC
TCCAACGAGCTGCGCTTCGAGGACGCGGCCGGCAGCGAGCTCGTCTATCTGCACGCGCAGAAGGACTTCA
ACATCGTCGTGGAGAACGACAAGACGCAGGAGGTCCGCGGCAACGAGACGTTGCTGGTGCGCAAGGACCG
CTCCCGCGTCATCGAGGGCAACCAGGCCCTGCTGGTGAAGAAGAACGACGACAGCACCGTCACCGGCAAC
CAGACGCTGGCCGTCACGCAGAACCGCTCCACCACCGTGGGCGGCAACCACACCGAGGCGGTGGCCGGAG
ACCAGTCCATCAGCGTCAGCGGCAACCAGGCCCTCACCGTGGCCATGGCCTCCGCGGAGACGGTGGCCCT
GGGGAAGATGCTCAACGTCGGCGGCGCGCTCGCCGTCACCGTGGGCGCCGCCTTCAACGAGCTGGTGGGC
GGCCTCAAGTCCGAACAGGTGGGCGGCGCCAAGGTGGAGGTCGTCGGCGCCAAGAAGTCCGAGACGGTCA
AGGGCGCCCGCACGCTCCAGGTGGGCGGAGACCTCTCCGAAGAGGTGGGCAAGTCCCGCACGCTCAAGGT
GGACAAGGACATGCTGGTCAGCGTGGCCGGCAAGGTGAACCACGCCGCCAAGGACGCCTACACCCTGTCC
GCCAAGGAAATCTCCCTGGTGGCCCAGGAGCAGTTCACCCTCAAGGTCGGCTCCGCCACGCTCCAGGTGA
AGAAGAACGGGGACGTGGTCATCAAGGGCGCCAAGGTCGAGGTCACCGCGACGGGCGACATCGTCATCAA
GGGCTCCAAGATTTCCGAGAACTAG