SecReT6
Protein ID: 338536018
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_31965
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7857418..7858002 [+]
Producthypothetical protein
NoteTssJ
UniProt IDF8C9J5
KEGG IDmfu:LILAB_18350, mfu:LILAB_31965
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.10E-27, Aligned region: 13..134
Protein Sequence: 194 a.a.     [Download]
>gi|338536018|ref|YP_004669352.1| unnamed protein product [Myxococcus fulvus HW-1]
MVIALAGTLGGSAGCVKRVPQACETPPPFQVVVDASEQLNPDARGRSLPTVVQIVQLKDSVRLERAGFKD
LWGKPEELLEEDLLQVAELIIPPGRQVKRWVQRDPKARFVMAMGHFRQPLGYSWRTVAALPVVEEARCVE
RPAGDQGDPKPGDEVFRYRLQGYQIDLMLRPMTRAPEPRLQPQAGDGVSPRRGV
 
Nucleotide Sequence: 585 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7857418-7858002 Myxococcus fulvus HW-1 chromosome, complete genome
GTGGTCATCGCGCTCGCGGGTACCCTGGGTGGGAGCGCGGGCTGCGTGAAGCGTGTGCCCCAGGCGTGTG
AGACGCCGCCGCCGTTCCAGGTGGTGGTGGATGCGTCGGAGCAGCTCAACCCGGACGCGCGGGGGCGCTC
GCTGCCCACGGTGGTGCAGATCGTCCAGCTCAAGGACAGCGTCCGGCTGGAGCGCGCGGGCTTCAAGGAT
TTGTGGGGCAAGCCGGAGGAGCTCCTCGAGGAGGACCTGCTCCAGGTGGCCGAGCTCATCATTCCGCCCG
GCCGCCAGGTGAAGCGCTGGGTGCAGCGCGATCCCAAGGCCCGCTTCGTCATGGCCATGGGGCACTTCCG
CCAGCCGCTGGGCTACTCGTGGCGGACGGTGGCGGCGCTCCCGGTGGTGGAGGAGGCGCGCTGCGTGGAG
CGCCCCGCCGGCGACCAGGGCGACCCCAAGCCGGGGGACGAGGTGTTCCGCTACCGGCTGCAAGGCTATC
AGATTGACTTGATGCTCCGGCCCATGACGCGGGCGCCGGAGCCTCGGCTCCAACCCCAAGCTGGCGACGG
CGTGTCGCCGCGGAGAGGTGTATGA