SecReT6
Protein ID: 338536019
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_31970
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7857999..7859366 [+]
Producthypothetical protein
NoteTssK
UniProt IDF8C9J6
KEGG IDmfu:LILAB_31970
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.80E-120, Aligned region: 19..450
Protein Sequence: 455 a.a.     [Download]
>gi|338536019|ref|YP_004669353.1| unnamed protein product [Myxococcus fulvus HW-1]
MKSVQRVVWSEGMFMSPHHLQQQDLYHEQLLDERLASLEPYPWGVVALEFDMEALRAGQVQLTHFAGILP
DGLPVSFESGDAEAPPARPADGYFPPAQRTLDVYLGVPRERSGVESFGSGERLGSSPRYTPASRPVSDLT
ASTSISQVAFGQRNVRLLFGTEPRDDFESIKLCELSRDRSGNLTLVESFIPSCLRINASPFIMNELRTML
RLMVSKQRQLSSRRRHRDASALEFTAGDVTLFLELNALNGTIPFLQHALDAGNLRPRDLYLALAQCAGQL
CTFSASADPSTLPAFQFTNLRATFEDLFRRLSELMRSVALEQCLSVELPAGTDGMFRGRLEDDRLERCGH
FILAVRSELPERVVAEQLPKLSKVAAWEDIRALVQAAAPGVPLSVTYRPPPEIPVQPGTVYFSLSMNDGY
WRNVMRDRNLAIYLPQPFDASRTTVELLAVPTANR
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7857999-7859366 Myxococcus fulvus HW-1 chromosome, complete genome
ATGAAGTCCGTGCAGCGAGTCGTGTGGTCGGAGGGCATGTTCATGAGCCCCCACCACCTCCAGCAGCAGG
ACCTCTACCACGAGCAACTGCTGGATGAGCGGCTGGCCTCGCTCGAACCCTACCCCTGGGGCGTGGTGGC
CCTGGAGTTCGACATGGAGGCGCTGCGCGCCGGCCAGGTGCAGCTCACCCACTTCGCGGGCATCCTCCCC
GACGGGCTGCCCGTCTCCTTCGAATCCGGAGACGCCGAGGCGCCGCCCGCGCGGCCCGCGGACGGCTACT
TCCCGCCCGCGCAGCGCACCCTGGACGTGTACCTGGGCGTGCCGCGCGAGCGCAGCGGCGTGGAGAGCTT
CGGCAGTGGTGAGCGGCTGGGCAGCAGCCCGCGCTACACGCCGGCCTCCCGCCCCGTCAGTGACTTGACG
GCCTCCACCTCCATCTCGCAGGTGGCCTTCGGTCAGCGCAACGTGCGGCTCCTGTTCGGCACCGAGCCGC
GGGACGACTTCGAGTCCATCAAGCTGTGCGAGCTGTCCAGGGACCGGTCCGGCAACCTGACGCTGGTCGA
GTCCTTCATCCCGTCCTGCCTGCGCATCAACGCGTCGCCGTTCATCATGAACGAGCTGCGCACGATGCTG
CGGCTGATGGTGTCCAAGCAGCGACAGCTCTCCTCGCGCCGGCGGCACCGGGACGCCTCCGCGCTGGAGT
TCACCGCGGGCGACGTGACGCTCTTCCTGGAGCTCAACGCGCTCAACGGCACCATCCCCTTCCTCCAGCA
CGCGCTGGACGCGGGCAACCTGCGGCCGCGGGACTTGTACCTGGCGCTGGCGCAGTGCGCGGGGCAGCTC
TGCACCTTCTCCGCCAGCGCGGACCCGTCCACCCTGCCCGCCTTCCAGTTCACCAACCTGCGCGCCACCT
TCGAGGACCTGTTCCGCCGCCTCTCCGAGCTGATGCGCTCGGTGGCGCTGGAGCAGTGCCTGTCGGTGGA
GCTGCCGGCGGGCACCGACGGCATGTTCCGCGGCCGGCTGGAGGACGACCGGCTGGAGCGCTGCGGGCAC
TTCATCCTCGCGGTGCGCAGCGAGCTGCCCGAGCGGGTGGTGGCCGAGCAGCTCCCCAAGCTGTCCAAGG
TGGCCGCCTGGGAGGACATCCGCGCGCTGGTGCAGGCGGCCGCCCCCGGCGTGCCGCTGTCGGTGACGTA
CCGCCCGCCGCCGGAGATCCCGGTGCAGCCGGGCACCGTCTACTTCAGCCTCTCCATGAATGACGGCTAC
TGGAGGAACGTCATGCGCGACCGGAACCTCGCCATCTACCTCCCGCAGCCGTTCGACGCGAGCCGAACGA
CCGTGGAACTGCTCGCGGTCCCCACCGCCAATCGCTGA