SecReT6
Protein ID: 338536020
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_31975
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7859382..7860098 [+]
Producthypothetical protein
NoteTssL
UniProt IDF8C9J7
KEGG IDmfu:LILAB_31975
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.80E-45, Aligned region: 4..205
TetR_C_6 [PF13977], Evalue: 0.0079, Aligned region: 31..70
Protein Sequence: 238 a.a.     [Download]
>gi|338536020|ref|YP_004669354.1| unnamed protein product [Myxococcus fulvus HW-1]
MDRVTEATKDCFDAAIQLRGSDASAVPPPETLHHRLRGVVDETLRRAAVLGFSHQDAQDMAYALVALIDE
VVLGRPEEYRQLWMPLQLHYFNENVAGDGFFARLNTVRKDPHRHEVLQVYYLCMLFGFQGRYRIRGGELE
LMTLIDTVQKDLERARPFDFDVLSPHGDRPTESLLSKRKKASAVGISAGALAVAVLFYGVLQFFLNDKVG
ELRSRIEVHAARNTATSASQTQAAGGAQ
 
Nucleotide Sequence: 717 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7859382-7860098 Myxococcus fulvus HW-1 chromosome, complete genome
ATGGACCGAGTCACCGAAGCCACAAAGGATTGTTTCGACGCCGCCATCCAGCTCCGCGGCTCCGATGCCT
CGGCGGTGCCCCCGCCGGAGACGCTGCACCACCGCCTGCGCGGCGTGGTGGACGAGACGCTGCGGCGCGC
CGCCGTGCTGGGCTTCAGCCATCAGGACGCCCAGGACATGGCCTACGCGCTGGTGGCGCTCATCGACGAG
GTCGTCCTGGGCCGGCCGGAGGAGTACCGGCAGCTCTGGATGCCCCTGCAGCTCCACTACTTCAACGAGA
ACGTCGCCGGTGACGGCTTCTTCGCGCGCCTCAACACCGTGCGCAAGGACCCGCACCGGCACGAGGTGCT
GCAGGTCTACTACCTGTGCATGCTCTTCGGCTTCCAGGGCCGCTACCGCATCCGCGGCGGCGAGCTGGAG
CTGATGACGCTCATCGACACGGTGCAGAAGGACCTGGAGCGCGCGCGGCCCTTCGACTTCGACGTGCTGT
CACCCCACGGGGACCGGCCCACCGAGTCGCTGCTCTCCAAGCGCAAGAAGGCCTCCGCGGTGGGCATCTC
CGCGGGCGCGCTGGCGGTGGCCGTCCTGTTCTACGGCGTGCTGCAGTTCTTCCTCAACGACAAGGTCGGT
GAGCTCAGAAGCCGCATTGAAGTCCACGCGGCCCGCAACACGGCGACGAGCGCCAGCCAGACGCAGGCGG
CCGGAGGGGCGCAGTGA