SecReT6
Protein ID: 338536023
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_31990
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7864817..7866715 [+]
Producthypothetical protein
NoteTssA
UniProt IDF8C9K0
KEGG IDmfu:LILAB_31990
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.70E-16, Aligned region: 29..88
ImpA-rel_N [PF06812], Evalue: 1.70E-16, Aligned region: 116..145
TPR_16 [PF13432], Evalue: 0.00041, Aligned region: 70..98
TPR_16 [PF13432], Evalue: 0.00041, Aligned region: 151..158
TPR_16 [PF13432], Evalue: 0.00041, Aligned region: 210..226
TPR_16 [PF13432], Evalue: 0.00041, Aligned region: 389..440
TPR_16 [PF13432], Evalue: 0.00041, Aligned region: 482..498
TPR_16 [PF13432], Evalue: 0.00041, Aligned region: 512..571
Protein Sequence: 632 a.a.     [Download]
>gi|338536023|ref|YP_004669357.1| unnamed protein product [Myxococcus fulvus HW-1]
MQAKHEPAYEAVALEVAKLESPASNAVRWDDVVEGAGDLLKHTTKDLWLAAYMAYGLYATRGVDGAATGA
AVLAEVTERYWQDLFPEAKRLRGRANAVAWFVDRLGRILPTVEQASVSAEPLDALATAVKHLAQLSRERF
SDMAPAFGPLQDAIARLRAGLPEPELASVTAGRSASPEDADGSRPPEAGNASPQDADGAGALRPDAAPDD
AAASATDRRAAGDADNGRHAAGPGAGNDSAESHGKAPQGPGNAKANAAHGPRGASGKGNAAQGAPAEKNA
PTAQGTAASQSAPARAAAVEVPPLPELPSTPDLSSAEAVTDFLRNVGGALLNASDALRRVSPEDPLSYRL
KRMGLWLHLTQPPAADGNGRTLIHPVPELLRTKLETLEQNQRWGDLLDECESALARHRFTLTLHRYSATA
LKGLGGAYAGARGALVQELAIQLRRMTGVETLLSTVGTPLTDDATRDWLRDEVLRASAPPPAGAATALST
ALALAPLALGTSVQGDGAALEAEARTLLDEGRVHEAVTRLQAAVTAASTGRARFISRLELARLCANAGQL
PLARAVYEALDEEVSAHALDTWEPALAAACLEGWLQTRTPAEKESGPVAVKFRNRYRRLALLDSSATLRV
GA
 
Nucleotide Sequence: 1899 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7864817-7866715 Myxococcus fulvus HW-1 chromosome, complete genome
GTGCAGGCGAAGCACGAGCCCGCCTACGAAGCCGTCGCGCTGGAGGTGGCGAAGCTGGAGTCCCCGGCCA
GCAACGCCGTGCGCTGGGATGACGTCGTCGAGGGCGCCGGCGACCTGCTGAAGCACACCACCAAGGACCT
CTGGCTCGCCGCGTACATGGCCTATGGCCTGTATGCCACGCGAGGCGTGGACGGCGCGGCCACCGGCGCC
GCGGTGCTCGCCGAGGTGACGGAGCGCTACTGGCAGGACCTCTTCCCGGAGGCGAAGCGGCTGCGCGGCC
GGGCCAACGCCGTGGCCTGGTTCGTGGACCGGCTGGGCCGCATCCTGCCCACCGTGGAGCAGGCCTCCGT
GAGCGCCGAGCCCCTGGATGCGCTGGCCACCGCGGTGAAGCACCTCGCCCAGCTCTCACGCGAGAGGTTC
TCGGACATGGCCCCCGCCTTCGGGCCGCTCCAGGACGCCATCGCCAGGCTCCGCGCGGGGCTCCCCGAAC
CCGAGCTTGCAAGCGTCACGGCTGGACGCAGCGCGTCCCCGGAGGACGCGGATGGCTCGCGTCCACCCGA
GGCCGGAAATGCGTCGCCCCAGGACGCGGACGGCGCAGGAGCCCTGCGGCCGGATGCGGCACCAGACGAC
GCGGCCGCGTCCGCCACGGACCGCCGCGCCGCCGGGGACGCGGACAATGGCAGGCACGCCGCGGGGCCAG
GCGCTGGCAATGACAGCGCGGAAAGCCATGGCAAGGCGCCCCAGGGCCCGGGCAATGCCAAGGCAAACGC
GGCACACGGCCCCCGTGGCGCCTCGGGCAAAGGCAACGCCGCGCAGGGCGCCCCCGCCGAGAAGAACGCC
CCCACGGCCCAGGGCACCGCCGCCTCGCAGAGCGCCCCCGCACGCGCCGCCGCCGTTGAAGTCCCGCCCC
TCCCGGAGCTGCCGTCCACGCCGGACCTGTCCAGCGCGGAGGCGGTGACGGACTTCCTGCGCAACGTGGG
CGGCGCGCTGCTGAACGCCTCGGACGCGCTGCGCCGGGTGAGCCCAGAGGACCCGCTCTCCTACCGCCTC
AAGCGCATGGGCCTGTGGCTGCACCTGACCCAGCCGCCCGCCGCGGATGGCAACGGGCGGACGCTGATCC
ACCCGGTGCCGGAGCTGCTGCGCACCAAGCTGGAGACCCTGGAGCAGAACCAGCGCTGGGGCGACCTGCT
GGATGAATGCGAGTCCGCGCTGGCCCGCCACCGCTTCACCCTGACGCTCCACCGCTACAGCGCCACCGCC
CTGAAGGGCCTGGGCGGCGCCTACGCGGGAGCCCGCGGCGCGCTGGTGCAGGAGCTGGCCATCCAGCTCA
GGCGGATGACGGGCGTGGAGACGCTCCTCTCCACCGTGGGCACCCCGCTCACGGACGACGCCACCCGGGA
CTGGCTGCGCGACGAGGTCCTCCGCGCGAGCGCGCCCCCACCGGCGGGCGCGGCCACCGCGCTGTCCACG
GCCCTGGCCCTGGCGCCCCTGGCGCTGGGGACGTCCGTCCAGGGCGACGGCGCGGCGCTGGAGGCCGAAG
CCCGCACGTTGCTCGACGAGGGCCGCGTTCACGAAGCCGTCACCCGGCTGCAGGCCGCCGTCACCGCCGC
CAGCACCGGCCGCGCGCGCTTCATCTCCCGGCTGGAGCTGGCGCGGCTGTGTGCCAATGCGGGCCAGTTG
CCGCTCGCGCGCGCCGTCTATGAGGCCTTGGACGAAGAGGTCTCCGCCCACGCGCTCGACACCTGGGAGC
CGGCGCTCGCCGCCGCGTGCCTGGAAGGGTGGCTGCAAACCCGAACGCCCGCTGAAAAGGAGTCGGGCCC
GGTGGCAGTGAAATTTCGAAACCGGTATCGTCGTCTAGCGTTGTTGGACTCTTCCGCCACGCTGCGCGTC
GGCGCTTGA