SecReT6
Protein ID: 338536024
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_31995
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7866798..7867292 [+]
Producthypothetical protein
NoteTssB
UniProt IDF8C9K1
KEGG IDmfu:LILAB_31995
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-55, Aligned region: 6..158
Protein Sequence: 164 a.a.     [Download]
>gi|338536024|ref|YP_004669358.1| unnamed protein product [Myxococcus fulvus HW-1]
MSKESSVAPTERVNIVYKPATGNAQEQVELPLKVLMLGDFTGQEDARPLEQRAPINVDKANFNEVMAQQN
LKVTLTAADKLSADPGATMNVSLQFKNLNDFSPESVVNQVPELKKLLELRSALNALKGPLGNLPAFRKKL
QALLADEDGRKALIKELGLTEETK
 
Nucleotide Sequence: 495 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7866798-7867292 Myxococcus fulvus HW-1 chromosome, complete genome
ATGAGCAAAGAGAGTTCCGTCGCCCCGACCGAGCGCGTCAACATCGTCTACAAGCCCGCCACCGGCAATG
CGCAGGAGCAGGTGGAGCTGCCGCTGAAGGTGCTGATGCTGGGTGACTTCACGGGGCAGGAAGACGCCCG
TCCGCTGGAGCAGCGCGCGCCCATCAACGTGGACAAGGCCAACTTCAACGAGGTCATGGCCCAGCAGAAC
CTCAAGGTCACGCTGACCGCCGCCGACAAGCTCTCGGCCGACCCGGGCGCCACGATGAACGTGTCGCTCC
AGTTCAAGAACCTGAATGACTTCTCGCCCGAGAGCGTCGTCAACCAGGTGCCGGAGCTGAAGAAGCTGCT
CGAGCTGCGCAGCGCGCTCAACGCCCTCAAGGGGCCCCTGGGCAACCTGCCGGCGTTCCGCAAGAAGCTC
CAGGCCCTGCTCGCCGACGAGGACGGCCGCAAGGCGCTCATCAAGGAACTGGGTCTGACCGAAGAGACCA
AGTAG