SecReT6
Protein ID: 338536025
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_32000
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7867318..7868802 [+]
Producthypothetical protein
NoteTssC
UniProt IDF8C9K2
KEGG IDmfu:LILAB_32000
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.90E-186, Aligned region: 67..492
Protein Sequence: 494 a.a.     [Download]
>gi|338536025|ref|YP_004669359.1| unnamed protein product [Myxococcus fulvus HW-1]
MANETQTQKSTGVANDASLSLLDEILSEAKLKPKDEGYDVAKRGVQAFITEMLAPNRAEERVDKALVDAM
IAEIDKRLSAQVNEILHAQEFQKLESSWRSLKFMVDRTDFRENTRVEMLNVSKDDLQKDFEDAPEVTKSG
LYKLVYSNEYGVFGGKPYGIISANYDFNVGPQDMELLRKCASVAAMAHAPFIGNAAPEVFGEESFLKLPD
LKDLKSLFEGPQYARWHSFRESEDARYVGLALPRFLLRLPYGEKTVPVKAFNFTEDVVGHHERYLWGHAS
VALTSRVADSFAKFRWSPNIIGPQSGGAVENLPLHQYEAMGEIQTKIPTEVMLTERREFELSEEGFIGLV
FRKDSDNAAFFSANSTQKPKFFGNTPEGKAAETNYRLGTQLPYMFIMTRLAHYIKVLQREQIGSWKEKSD
LERELNHWLSQYISDMDDPAPAVRSRRPLRAARVVVEDVDGQPGWYRCSLQVRPHFKYMGASFTLSLVGK
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7867318-7868802 Myxococcus fulvus HW-1 chromosome, complete genome
ATGGCCAACGAGACCCAGACCCAGAAGTCCACGGGCGTCGCCAATGACGCCTCGCTGTCCCTGCTCGACG
AAATCCTGTCCGAGGCCAAGCTGAAGCCGAAGGACGAGGGTTACGACGTCGCCAAGCGCGGCGTGCAGGC
CTTCATCACGGAGATGCTGGCGCCCAACCGCGCCGAGGAGCGCGTGGACAAGGCGCTCGTCGACGCGATG
ATCGCCGAAATCGACAAGCGGCTGTCCGCCCAGGTCAACGAAATCCTCCACGCGCAGGAGTTCCAGAAGC
TGGAGTCCTCGTGGCGCTCGCTGAAGTTCATGGTGGACCGCACCGACTTCCGCGAGAACACCCGCGTGGA
GATGCTCAACGTCTCCAAGGACGACCTCCAGAAGGACTTCGAGGACGCGCCGGAGGTCACCAAGAGCGGC
CTGTACAAGCTGGTGTACTCCAACGAGTACGGCGTCTTCGGCGGCAAGCCCTACGGCATCATCTCCGCCA
ACTACGACTTCAACGTGGGCCCGCAGGACATGGAGCTCTTGCGCAAGTGCGCCTCCGTGGCCGCCATGGC
GCACGCGCCCTTCATCGGCAACGCCGCGCCGGAGGTGTTCGGCGAGGAGAGCTTCCTCAAGCTGCCCGAC
CTGAAGGACCTCAAGTCCCTCTTCGAGGGTCCGCAGTACGCCCGCTGGCACTCCTTCCGCGAGAGCGAGG
ACGCGCGCTACGTGGGCCTGGCGCTGCCGCGCTTCCTGCTGCGCCTGCCCTACGGTGAGAAGACGGTGCC
GGTGAAGGCCTTCAACTTCACCGAGGACGTCGTGGGCCACCACGAGCGCTACCTGTGGGGTCACGCCTCC
GTGGCCCTCACCAGCCGCGTGGCGGACTCGTTCGCCAAGTTCCGCTGGAGCCCGAACATCATCGGGCCCC
AGTCCGGCGGCGCGGTGGAGAACCTGCCGCTGCACCAGTACGAGGCCATGGGGGAGATCCAGACCAAGAT
TCCCACCGAGGTCATGCTCACCGAGCGGCGCGAGTTCGAGCTCTCCGAGGAGGGCTTCATCGGGCTCGTG
TTCCGCAAGGACTCCGACAACGCGGCCTTCTTCAGCGCCAACTCCACGCAGAAGCCCAAGTTCTTCGGCA
ACACGCCCGAGGGCAAGGCGGCGGAGACCAACTACCGCCTGGGCACGCAGCTTCCCTACATGTTCATCAT
GACCCGCCTGGCGCACTACATCAAAGTGCTCCAGCGCGAGCAGATTGGAAGCTGGAAGGAGAAGTCCGAC
CTGGAGCGCGAGCTCAACCACTGGCTCAGCCAGTACATCTCCGACATGGACGACCCCGCGCCCGCCGTGC
GCTCGCGCCGCCCCCTGCGCGCCGCGCGCGTGGTGGTGGAGGACGTGGACGGTCAGCCGGGCTGGTACCG
CTGCAGCCTGCAGGTGCGCCCCCACTTCAAGTACATGGGCGCGTCGTTCACCCTGTCGCTCGTCGGCAAG
TTGGACAAGGAGTAG