SecReT6
Protein ID: 338536026
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_32005
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7868922..7869413 [+]
Producthypothetical protein
NoteTssD
UniProt IDF8C9K3
KEGG IDmfu:LILAB_32005
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.70E-31, Aligned region: 8..148
Protein Sequence: 163 a.a.     [Download]
>gi|338536026|ref|YP_004669360.1| unnamed protein product [Myxococcus fulvus HW-1]
MAESVHLYLKANGTDIKGDSTQTSLGRADSIECVAYSQKVFTAREAGSGLATGRRQYEGIEITKRIDKAS
PLLMKALCENQVIDATFKFFRPNPTGDGTTEQFYTVSVKKARINAIQQTVPNSFVPASTNLPPMETVQLV
FHTINWTITNGGVTHEDTWDTQR
 
Nucleotide Sequence: 492 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7868922-7869413 Myxococcus fulvus HW-1 chromosome, complete genome
ATGGCTGAATCAGTACACCTGTACCTGAAGGCGAACGGGACGGACATCAAGGGCGACAGCACGCAGACCA
GCCTGGGCCGCGCTGACTCCATCGAGTGCGTGGCCTACAGCCAGAAGGTCTTCACCGCTCGCGAGGCCGG
CTCCGGTCTGGCGACGGGCCGCCGCCAGTACGAGGGCATCGAAATCACCAAGCGCATCGACAAGGCGTCG
CCGCTGCTGATGAAGGCCCTGTGCGAGAACCAGGTCATCGACGCGACCTTCAAGTTCTTCCGTCCCAACC
CGACGGGCGACGGCACCACCGAGCAGTTCTACACGGTGTCCGTCAAGAAGGCGCGCATCAACGCCATCCA
GCAGACGGTGCCGAACTCCTTCGTCCCCGCGAGCACCAACCTGCCCCCGATGGAGACCGTCCAGCTGGTG
TTCCACACCATCAACTGGACCATCACCAACGGCGGCGTCACGCACGAGGACACCTGGGACACCCAGCGTT
GA