SecReT6
Protein ID: 338536027
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_32010
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7869496..7869891 [+]
Producthypothetical protein
NoteTssE
UniProt IDF8C9K4
KEGG IDmfu:LILAB_32010
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-22, Aligned region: 22..113
Protein Sequence: 131 a.a.     [Download]
>gi|338536027|ref|YP_004669361.1| unnamed protein product [Myxococcus fulvus HW-1]
MGSRGLLSRIAEGNGTLAPPGDVVESIAEHLRSLLNTRKGESVASPGYGILDLNDVVHSYPSAIPRMTQS
IRQAIQEFEPRLKSVVVNYNADPVDPTALRFDITAQLATRDRRGMVRFHTQVHPGGRVDLW
 
Nucleotide Sequence: 396 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7869496-7869891 Myxococcus fulvus HW-1 chromosome, complete genome
ATGGGCTCCCGAGGCTTGTTGTCGCGCATCGCTGAAGGCAACGGCACGCTCGCCCCACCTGGCGACGTCG
TTGAATCCATCGCCGAGCACCTGCGCAGCCTGCTCAACACACGCAAGGGGGAGTCCGTGGCGTCGCCGGG
CTACGGCATCCTGGACCTGAACGACGTCGTCCACTCCTACCCGTCGGCGATACCGCGGATGACGCAGTCC
ATCCGGCAGGCCATCCAGGAGTTCGAGCCGCGCCTGAAGAGCGTGGTGGTGAATTACAACGCGGATCCGG
TGGACCCGACGGCGCTGCGCTTCGACATCACCGCCCAGTTGGCCACCCGGGACCGGCGCGGCATGGTGCG
CTTCCACACCCAGGTGCATCCAGGCGGGCGCGTGGACCTGTGGTGA