SecReT6
Protein ID: 338536028
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_32015
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7869928..7871679 [+]
Producthypothetical protein
NoteTssF
UniProt IDF8C9K5
KEGG IDmfu:LILAB_32015
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.00E-182, Aligned region: 2..583
Protein Sequence: 583 a.a.     [Download]
>gi|338536028|ref|YP_004669362.1| unnamed protein product [Myxococcus fulvus HW-1]
MFSKYYLSELSYLREMGRAFGLANPSVAGLLVERGADPDVERLLEGFAFLAARIRERVDDDVPELVHGLT
ELLLPHYLRPLPASTIIEFTPHLRALRGRSRLPAGAEVASQPIDGTSCVFRTTTDVDLLPVQLTDALLDR
SSITAPVLRLFFQTTEQGRAEVLREQGLRLFIHADLSAASVVLLWLLRYCRQVRVRGVAAQGEGIKLAAN
AIQPVGFHRDFKLLPWPRASEGYRHLQEYLTLPEKFLFFEVRGLDAAAGLKEDRFELAFHLERPPPLDAR
IHREMFRLHCAPVVNLFSVPADPVLHRALDREHLLRASDLPPNHAEIYSVDTVTGLKAGRNERRVYRPFY
EFTHTAGGDAEQAFYRLRRAPSPLDEGIDTYITLETPRNVAPDVAGEEALSMDLTCTNRSLPSRLQVGDL
TASTSASPTQAKFKNISPVSRPARAPLGSELHWRLLSHLAINQHSLADAAALRRLMDLYNFHSLTDNLAA
RASRLRINAIRAVETKPVTRFLEGAPLRGHRTRVDLDEENFMGVGDSFLFGCVLEELLASHVTINSFNEL
SIRLHPSQTEFAWLPRNGTQTLL
 
Nucleotide Sequence: 1752 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7869928-7871679 Myxococcus fulvus HW-1 chromosome, complete genome
ATGTTCAGCAAGTATTACCTGAGCGAGCTGTCGTACCTGCGGGAGATGGGGCGCGCCTTCGGGCTGGCCA
ACCCCTCCGTCGCGGGCCTGTTGGTGGAGCGCGGCGCGGACCCGGACGTGGAGCGGCTGCTGGAGGGCTT
CGCGTTCCTGGCGGCCCGCATCCGCGAGCGCGTGGACGACGACGTGCCGGAGCTGGTGCACGGCCTCACC
GAGCTGCTGCTGCCGCACTACCTGCGGCCCCTGCCCGCCTCCACCATCATCGAGTTCACCCCCCACCTGC
GCGCGCTGCGCGGCCGCTCGCGGCTGCCGGCGGGGGCGGAGGTGGCGTCCCAGCCCATTGACGGCACGAG
CTGCGTCTTCCGCACCACCACGGACGTGGACCTGCTGCCGGTGCAGCTCACCGACGCGCTCCTGGACCGC
TCGTCCATCACCGCGCCGGTGCTGCGGCTCTTCTTCCAGACGACGGAGCAGGGCCGCGCGGAGGTGCTGC
GCGAGCAGGGCCTGCGCCTGTTCATCCACGCCGACCTGTCCGCCGCGTCGGTGGTGCTCCTGTGGCTGTT
GCGCTACTGCCGTCAGGTGCGCGTGCGCGGCGTGGCCGCGCAAGGTGAAGGCATCAAGCTGGCGGCGAAC
GCCATCCAGCCGGTGGGCTTCCACCGCGACTTCAAGCTGCTGCCCTGGCCCCGCGCCAGCGAGGGCTACC
GGCACCTCCAGGAGTACCTGACGCTGCCAGAGAAGTTCCTCTTCTTCGAGGTGCGGGGACTGGACGCCGC
CGCCGGGCTGAAGGAGGACCGCTTCGAGCTCGCCTTCCACCTGGAGCGGCCGCCGCCCCTGGACGCGCGC
ATCCACCGGGAGATGTTCCGGCTGCACTGCGCGCCGGTGGTGAACCTCTTCAGCGTGCCGGCGGACCCCG
TCCTCCACCGCGCGCTGGACCGCGAGCACCTGCTGCGCGCGTCCGACCTGCCGCCCAACCACGCGGAGAT
CTACTCGGTGGACACGGTGACGGGCCTGAAGGCGGGGCGCAACGAGCGCCGCGTCTACCGGCCCTTCTAC
GAGTTCACGCACACGGCGGGCGGGGACGCGGAGCAGGCCTTCTACCGGCTGCGCCGGGCGCCCTCGCCGC
TGGACGAAGGCATCGACACGTACATCACCCTGGAGACGCCGCGGAACGTCGCGCCGGACGTCGCCGGGGA
GGAGGCGCTGTCCATGGACCTGACGTGCACCAACCGCTCGCTGCCCTCGCGGCTGCAGGTGGGGGACCTG
ACGGCCTCCACGTCCGCCAGTCCCACGCAGGCGAAGTTCAAGAACATCTCCCCCGTGAGCCGGCCGGCGC
GCGCGCCGCTGGGCTCCGAGCTGCACTGGCGGCTGCTGTCGCACCTGGCCATCAACCAGCACTCGCTGGC
GGACGCGGCCGCGCTGCGGCGGCTGATGGACCTGTACAACTTCCACTCGCTCACCGACAACCTGGCGGCG
CGCGCCAGCCGCCTGCGCATCAACGCCATCCGCGCGGTGGAGACGAAGCCGGTGACGCGCTTCCTGGAGG
GCGCGCCGCTGCGGGGCCACCGCACGCGGGTGGACCTGGACGAAGAGAACTTCATGGGCGTGGGGGACTC
GTTCCTCTTCGGCTGCGTGCTGGAGGAACTGCTCGCCTCCCACGTCACCATCAACTCCTTCAACGAGCTG
AGCATCCGGCTTCACCCCTCGCAGACGGAGTTCGCGTGGCTTCCGAGGAACGGCACCCAGACGCTCTTGT
AG