SecReT6
Protein ID: 338536029
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_32020
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7871715..7872686 [+]
Producthypothetical protein
NoteTssG
UniProt IDF8C9K6
KEGG IDmfu:LILAB_32020
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.20E-73, Aligned region: 2..310
Protein Sequence: 323 a.a.     [Download]
>gi|338536029|ref|YP_004669363.1| unnamed protein product [Myxococcus fulvus HW-1]
MGFFPLVAFLERLTSQATRVGGAGPVNEEMIRFRHDPSLGFSSGDVTSVTLHQVPVRAEDPYSKRPLFEV
VTRFLGLTGAVSPLPHFMAEEVAQEDPDHPVRREFLDLFHHRLLSLLYRIESKYRVTSETDTSFSDQWSR
RLLALGGFDTYERPLEGTLPTWRLLRIAPLLASRSRTSEQLEVALEDVLGEDLEGARVSVRQFVGRWVDI
DARARLGHSNHQLGRNMLLGGKAFDRTGKIQIHIRPLPPRAYKRLMQEGDLLPLVREVVALFVRDPLEYD
LELGLTEGVQHQFRLSSKEPSQLGRDTWLGLSQQTQLSVPVVK
 
Nucleotide Sequence: 972 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7871715-7872686 Myxococcus fulvus HW-1 chromosome, complete genome
GTGGGTTTCTTCCCGCTGGTGGCGTTCCTGGAGCGGCTGACGTCGCAGGCCACCCGCGTGGGCGGCGCGG
GGCCCGTCAACGAGGAGATGATTCGCTTCCGGCATGACCCGTCCCTGGGCTTCTCCTCCGGGGACGTCAC
GTCGGTGACGCTGCACCAGGTGCCGGTGCGGGCGGAGGACCCGTACTCGAAGCGGCCGCTCTTCGAGGTG
GTGACGCGCTTCCTGGGTCTGACGGGCGCGGTGAGCCCCCTGCCGCACTTCATGGCGGAGGAGGTCGCGC
AGGAGGACCCGGACCACCCGGTGCGGCGCGAGTTCCTGGACCTCTTCCACCACCGGCTGCTGTCGCTGCT
GTACCGCATCGAATCGAAGTACCGCGTCACCAGCGAGACGGACACGTCCTTCTCGGACCAGTGGTCCCGG
CGCCTGCTGGCGCTGGGGGGCTTCGACACCTACGAGCGGCCCCTGGAAGGGACGCTGCCCACCTGGCGCC
TGCTGCGCATCGCCCCGCTGCTGGCCAGCCGGTCCAGGACGTCCGAGCAACTGGAGGTCGCGCTCGAGGA
CGTGCTGGGCGAGGACCTGGAGGGCGCGCGCGTGTCGGTGCGCCAGTTCGTGGGGCGCTGGGTGGACATC
GACGCCCGGGCGCGCCTGGGCCACTCCAACCACCAGCTCGGCCGCAACATGCTGCTGGGGGGCAAGGCCT
TCGACAGGACGGGGAAGATTCAAATCCACATCCGGCCGCTGCCGCCGCGCGCCTACAAGCGGCTGATGCA
GGAGGGGGACCTGCTGCCCCTGGTGCGGGAGGTGGTGGCGCTCTTCGTGAGGGACCCCCTGGAGTACGAT
TTGGAGCTGGGGCTCACCGAGGGCGTGCAGCACCAGTTCCGGCTCTCCAGCAAGGAGCCGAGCCAGCTCG
GGCGGGACACCTGGCTGGGCCTGAGCCAGCAGACGCAACTGAGCGTCCCCGTGGTGAAATGA