SecReT6
Protein ID: 338536030
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_32025
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7872808..7875384 [+]
ProductATP-dependent chaperone protein ClpB
NoteTssH
UniProt IDF8C9K7
KEGG IDmfu:LILAB_32025
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.60E-40, Aligned region: 203..224
AAA_2 [PF07724], Evalue: 6.60E-40, Aligned region: 589..754
AAA [PF00004], Evalue: 3.00E-20, Aligned region: 205..310
AAA [PF00004], Evalue: 3.00E-20, Aligned region: 593..712
ClpB_D2-small [PF10431], Evalue: 4.20E-15, Aligned region: 762..832
AAA_5 [PF07728], Evalue: 8.30E-12, Aligned region: 205..225
AAA_5 [PF07728], Evalue: 8.30E-12, Aligned region: 593..713
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 82..134
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 182..221
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 248..283
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 441..463
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 584..616
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 657..687
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 756..792
AAA_22 [PF13401], Evalue: 2.90E-07, Aligned region: 204..286
AAA_22 [PF13401], Evalue: 2.90E-07, Aligned region: 591..615
AAA_25 [PF13481], Evalue: 6.30E-07, Aligned region: 205..270
AAA_25 [PF13481], Evalue: 6.30E-07, Aligned region: 261..301
AAA_25 [PF13481], Evalue: 6.30E-07, Aligned region: 446..487
AAA_25 [PF13481], Evalue: 6.30E-07, Aligned region: 460..488
AAA_25 [PF13481], Evalue: 6.30E-07, Aligned region: 591..625
IstB_IS21 [PF01695], Evalue: 2.10E-06, Aligned region: 198..228
IstB_IS21 [PF01695], Evalue: 2.10E-06, Aligned region: 593..613
IstB_IS21 [PF01695], Evalue: 2.10E-06, Aligned region: 704..724
AAA_19 [PF13245], Evalue: 3.30E-05, Aligned region: 202..225
AAA_19 [PF13245], Evalue: 3.30E-05, Aligned region: 593..615
NACHT [PF05729], Evalue: 4.40E-05, Aligned region: 205..232
NACHT [PF05729], Evalue: 4.40E-05, Aligned region: 592..628
NACHT [PF05729], Evalue: 4.40E-05, Aligned region: 822..846
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 205..244
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 507..507
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 594..616
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 183..219
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 258..288
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 592..605
Clp_N [PF02861], Evalue: 0.00045, Aligned region: 12..50
AAA_18 [PF13238], Evalue: 0.00056, Aligned region: 205..224
AAA_18 [PF13238], Evalue: 0.00056, Aligned region: 595..622
AAA_29 [PF13555], Evalue: 0.00076, Aligned region: 199..224
AAA_29 [PF13555], Evalue: 0.00076, Aligned region: 591..618
AAA_23 [PF13476], Evalue: 0.0011, Aligned region: 205..233
AAA_23 [PF13476], Evalue: 0.0011, Aligned region: 406..454
AAA_23 [PF13476], Evalue: 0.0011, Aligned region: 591..619
Sigma54_activat [PF00158], Evalue: 0.0013, Aligned region: 188..219
Sigma54_activat [PF00158], Evalue: 0.0013, Aligned region: 593..693
DUF258 [PF03193], Evalue: 0.0014, Aligned region: 181..222
DUF258 [PF03193], Evalue: 0.0014, Aligned region: 592..605
RuvB_N [PF05496], Evalue: 0.0021, Aligned region: 204..221
RuvB_N [PF05496], Evalue: 0.0021, Aligned region: 275..285
RuvB_N [PF05496], Evalue: 0.0021, Aligned region: 554..614
AAA_33 [PF13671], Evalue: 0.0029, Aligned region: 205..222
AAA_33 [PF13671], Evalue: 0.0029, Aligned region: 478..508
AAA_33 [PF13671], Evalue: 0.0029, Aligned region: 592..614
RNA_helicase [PF00910], Evalue: 0.004, Aligned region: 206..226
RNA_helicase [PF00910], Evalue: 0.004, Aligned region: 594..615
ResIII [PF04851], Evalue: 0.008, Aligned region: 189..222
ResIII [PF04851], Evalue: 0.008, Aligned region: 275..286
ResIII [PF04851], Evalue: 0.008, Aligned region: 564..615
Protein Sequence: 858 a.a.     [Download]
>gi|338536030|ref|YP_004669364.1| unnamed protein product [Myxococcus fulvus HW-1]
MARASAGRFYEIVPEHLLVQMLEPEDSDVARILQQFGVDRRQLLASMERALQGLRAGNAGRPVFSETLFQ
WFEEAWLLASVEQGATRLRSGLLFTQFVSRRSRYTAELFPELDAIRRDELLESLDVVLRPSPENVEVATA
DAAASGAAGGVAGGAGSRGDEALKRFATSFTGRVREGKIDPIFGRHREIRQMVDILSRRRKNNPILVGEP
GVGKTALVEGLAWAIVRGEVPDALKNVELLGLDLGLLQAGAGVRGEFENRLKAVIAEVKASPTPIILFID
EAHTIIGAGGSQGGTDASNLLKPALARGELRTLAATTWAEYKKYFEKDAALERRFQPVKVEEPGVEDAEL
MLRGLRPTYEAAHGVIIRDEAVTAAVHLSSRYISGRQLPDKAVDLLDTSAARVKIELSTRPEELVQLDQE
ISALERERDARKRDLAESTGGTDAQATLEEVEAKLSATVDSRAALHARWETERTAVAALLEARKALREAP
ADTDTAPLKAAVDEAAAKLAATRGEVPLVHADVDADIVARVVAGWTGVPVGKMRSDLLESVLNLEDKLRG
RVRGQEAALTKVAEIIRISQAGIRNPDTPIGVMLFVGPSGVGKTETALALADALYGGERFMTTLNMSEFQ
EKHTVSRLIGSPPGYVGYGEGGLLTEAVRQRPYSVVLLDECEKADLEVMNLFYQVFDKGSLTDGEGRAVD
FKNTVLILTSNLGSDLVMRMFEDGAQPTSEEVLSVIRPTLSQHFKPALLARMTVVPFGPVQRDVMRQIAE
MKLAKLVGRLREAHNVETTLAPELLDELARRCTESEMGARNMEQILQGSLMPALSRELLQHLVGGAVPPK
LHVALTETGDWDLRFAEA
 
Nucleotide Sequence: 2577 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7872808-7875384 Myxococcus fulvus HW-1 chromosome, complete genome
GTGGCCCGGGCAAGCGCGGGACGGTTCTATGAAATCGTCCCGGAGCACCTGCTGGTGCAGATGCTGGAGC
CAGAGGACTCGGACGTCGCGCGCATCCTCCAGCAGTTCGGCGTGGACCGCCGCCAGCTCCTGGCCAGCAT
GGAGCGCGCCCTCCAGGGCCTGCGCGCGGGCAACGCCGGCCGCCCCGTCTTCTCCGAGACGCTGTTCCAG
TGGTTCGAGGAGGCGTGGCTGCTGGCCTCCGTGGAGCAGGGCGCCACGCGGCTGCGCTCGGGCCTGCTCT
TCACGCAGTTCGTCAGTCGGCGCTCGCGCTACACCGCGGAGCTGTTCCCGGAGCTGGACGCCATCCGCCG
CGACGAGCTGTTGGAATCGCTGGACGTGGTGCTGCGGCCGTCGCCGGAGAACGTGGAGGTCGCCACCGCG
GACGCCGCCGCCAGTGGCGCCGCGGGCGGCGTGGCCGGTGGCGCGGGGAGCCGCGGGGACGAGGCCCTCA
AGCGCTTCGCCACCTCCTTCACCGGCCGGGTGCGCGAGGGGAAGATCGACCCCATCTTCGGCCGGCACCG
TGAAATCCGGCAGATGGTGGACATCCTCTCCCGCCGCCGGAAGAACAACCCCATCCTGGTGGGCGAGCCC
GGCGTGGGCAAGACGGCGCTGGTGGAGGGCCTGGCCTGGGCCATTGTCCGGGGCGAGGTGCCCGACGCGC
TGAAGAACGTGGAGCTGCTGGGGCTGGACCTGGGCCTGCTCCAGGCGGGCGCGGGCGTGCGCGGCGAGTT
CGAGAACCGCCTCAAGGCCGTCATCGCCGAGGTGAAGGCCTCCCCCACCCCCATCATCCTGTTCATCGAC
GAGGCGCACACCATCATCGGCGCGGGCGGCTCGCAGGGCGGCACGGACGCGTCCAACCTGCTCAAGCCGG
CGCTGGCGCGCGGCGAGCTGCGCACGCTCGCGGCCACCACCTGGGCCGAGTACAAGAAGTACTTCGAGAA
GGACGCCGCGCTGGAGCGGCGCTTCCAGCCGGTGAAGGTGGAGGAGCCTGGCGTGGAGGACGCGGAGCTG
ATGCTGCGCGGCCTGCGGCCCACCTACGAGGCGGCCCACGGCGTCATCATCCGCGACGAGGCCGTCACCG
CCGCGGTGCACCTGTCCAGCCGCTACATCTCCGGCCGGCAGCTCCCGGACAAGGCGGTGGACCTGCTCGA
CACGTCCGCGGCCCGGGTGAAGATTGAGCTGTCCACCCGGCCCGAGGAGCTGGTGCAGTTGGACCAGGAG
ATTTCGGCGCTGGAGCGCGAGCGCGACGCGCGCAAGCGCGACCTGGCGGAGAGCACGGGCGGCACGGACG
CCCAGGCCACGCTGGAGGAGGTGGAGGCGAAGCTGAGCGCCACGGTGGACAGCCGCGCCGCGCTGCACGC
GCGCTGGGAGACCGAGCGCACCGCGGTGGCGGCGCTGCTGGAGGCGCGCAAGGCCCTGCGCGAGGCGCCC
GCGGACACGGACACCGCGCCCCTGAAGGCGGCGGTGGACGAAGCGGCGGCGAAGCTGGCCGCCACGCGCG
GCGAGGTGCCGCTGGTGCACGCGGACGTGGACGCGGACATCGTCGCGCGCGTCGTCGCGGGCTGGACGGG
CGTGCCCGTGGGGAAGATGCGCAGCGACCTGCTCGAGTCCGTGCTCAACCTGGAGGACAAGCTCCGGGGC
CGGGTGCGCGGCCAGGAGGCGGCGCTGACGAAGGTTGCGGAGATCATCCGCATCTCCCAGGCGGGCATCC
GCAACCCGGACACGCCCATTGGCGTCATGCTCTTCGTGGGCCCCAGCGGCGTGGGCAAGACGGAGACGGC
GCTGGCGCTGGCGGACGCGCTGTACGGCGGCGAGCGCTTCATGACGACGCTCAACATGAGCGAGTTCCAG
GAGAAGCACACGGTGAGCCGGCTCATCGGCTCGCCGCCGGGCTACGTGGGCTATGGCGAGGGCGGCCTGC
TGACGGAGGCGGTGCGGCAGCGGCCCTACTCCGTCGTGCTGCTGGACGAGTGCGAGAAGGCCGACCTGGA
GGTGATGAACCTCTTCTACCAGGTGTTCGACAAGGGCTCGCTGACGGACGGCGAGGGCCGCGCGGTGGAC
TTCAAGAACACCGTGCTCATCCTCACCAGCAACCTGGGCTCGGACCTGGTGATGCGGATGTTCGAGGACG
GCGCGCAGCCCACCTCCGAGGAGGTGCTGTCGGTGATTCGGCCCACGCTCAGCCAGCACTTCAAGCCGGC
GCTGCTGGCGCGAATGACGGTGGTGCCCTTCGGCCCGGTGCAGCGCGACGTGATGCGCCAGATCGCGGAG
ATGAAGCTGGCCAAGCTGGTGGGCCGGCTGCGCGAGGCGCACAACGTGGAGACCACGCTGGCGCCGGAGC
TGCTGGACGAGCTGGCGCGCCGGTGCACCGAGTCGGAGATGGGGGCGCGCAACATGGAGCAGATCCTCCA
GGGCTCGCTGATGCCGGCGCTGTCCCGCGAGCTGTTGCAGCACCTGGTGGGCGGCGCGGTGCCCCCGAAG
CTGCACGTGGCCCTGACCGAGACAGGCGACTGGGACCTCCGGTTCGCCGAGGCCTGA