SecReT6
Protein ID: 338536040
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_32075
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7885878..7889249 [+]
ProductClpB family protein
NoteTssH
UniProt IDF8C9L7
KEGG IDmfu:LILAB_32075
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.90E-34, Aligned region: 264..365
AAA_2 [PF07724], Evalue: 5.90E-34, Aligned region: 534..697
AAA_2 [PF07724], Evalue: 5.90E-34, Aligned region: 851..887
AAA_5 [PF07728], Evalue: 3.00E-15, Aligned region: 264..290
AAA_5 [PF07728], Evalue: 3.00E-15, Aligned region: 539..639
AAA [PF00004], Evalue: 3.70E-15, Aligned region: 264..368
AAA [PF00004], Evalue: 3.70E-15, Aligned region: 539..620
ClpB_D2-small [PF10431], Evalue: 2.70E-13, Aligned region: 704..776
AAA_17 [PF13207], Evalue: 2.40E-10, Aligned region: 264..303
AAA_17 [PF13207], Evalue: 2.40E-10, Aligned region: 539..574
AAA_17 [PF13207], Evalue: 2.40E-10, Aligned region: 853..900
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 243..398
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 510..563
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 595..622
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 837..912
AAA_33 [PF13671], Evalue: 2.50E-08, Aligned region: 264..382
AAA_33 [PF13671], Evalue: 2.50E-08, Aligned region: 538..560
AAA_18 [PF13238], Evalue: 6.80E-08, Aligned region: 264..293
AAA_18 [PF13238], Evalue: 6.80E-08, Aligned region: 541..568
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 260..289
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 537..560
IstB_IS21 [PF01695], Evalue: 3.10E-07, Aligned region: 250..284
IstB_IS21 [PF01695], Evalue: 3.10E-07, Aligned region: 539..558
AAA_29 [PF13555], Evalue: 4.30E-07, Aligned region: 261..290
AAA_29 [PF13555], Evalue: 4.30E-07, Aligned region: 537..564
DUF258 [PF03193], Evalue: 3.50E-06, Aligned region: 262..289
DUF258 [PF03193], Evalue: 3.50E-06, Aligned region: 538..557
AAA_23 [PF13476], Evalue: 5.20E-06, Aligned region: 264..286
AAA_23 [PF13476], Evalue: 5.20E-06, Aligned region: 537..579
AAA_23 [PF13476], Evalue: 5.20E-06, Aligned region: 857..923
ABC_tran [PF00005], Evalue: 8.30E-06, Aligned region: 257..286
ABC_tran [PF00005], Evalue: 8.30E-06, Aligned region: 539..560
MobB [PF03205], Evalue: 1.40E-05, Aligned region: 263..286
MobB [PF03205], Evalue: 1.40E-05, Aligned region: 538..568
Sigma54_activat [PF00158], Evalue: 5.90E-05, Aligned region: 258..284
Sigma54_activat [PF00158], Evalue: 5.90E-05, Aligned region: 539..634
RNA_helicase [PF00910], Evalue: 5.90E-05, Aligned region: 264..299
RNA_helicase [PF00910], Evalue: 5.90E-05, Aligned region: 540..561
NACHT [PF05729], Evalue: 6.40E-05, Aligned region: 264..301
NACHT [PF05729], Evalue: 6.40E-05, Aligned region: 539..560
Zeta_toxin [PF06414], Evalue: 8.20E-05, Aligned region: 262..286
Zeta_toxin [PF06414], Evalue: 8.20E-05, Aligned region: 368..433
Zeta_toxin [PF06414], Evalue: 8.20E-05, Aligned region: 538..574
AAA_30 [PF13604], Evalue: 0.00015, Aligned region: 110..131
AAA_30 [PF13604], Evalue: 0.00015, Aligned region: 259..303
AAA_30 [PF13604], Evalue: 0.00015, Aligned region: 379..424
AAA_30 [PF13604], Evalue: 0.00015, Aligned region: 538..563
AAA_28 [PF13521], Evalue: 0.00035, Aligned region: 264..293
AAA_28 [PF13521], Evalue: 0.00035, Aligned region: 362..388
AAA_28 [PF13521], Evalue: 0.00035, Aligned region: 540..559
AAA_28 [PF13521], Evalue: 0.00035, Aligned region: 843..917
AAA_19 [PF13245], Evalue: 0.00037, Aligned region: 261..287
AAA_19 [PF13245], Evalue: 0.00037, Aligned region: 538..563
AAA_14 [PF13173], Evalue: 0.00039, Aligned region: 262..286
AAA_14 [PF13173], Evalue: 0.00039, Aligned region: 538..619
SRP54 [PF00448], Evalue: 0.00055, Aligned region: 263..287
SRP54 [PF00448], Evalue: 0.00055, Aligned region: 538..563
RuvB_N [PF05496], Evalue: 0.00063, Aligned region: 253..287
RuvB_N [PF05496], Evalue: 0.00063, Aligned region: 530..559
AAA_3 [PF07726], Evalue: 0.00074, Aligned region: 264..287
AAA_3 [PF07726], Evalue: 0.00074, Aligned region: 542..650
Mg_chelatase [PF01078], Evalue: 0.00083, Aligned region: 261..294
Mg_chelatase [PF01078], Evalue: 0.00083, Aligned region: 539..563
Mg_chelatase [PF01078], Evalue: 0.00083, Aligned region: 590..629
UPF0079 [PF02367], Evalue: 0.0012, Aligned region: 259..286
UPF0079 [PF02367], Evalue: 0.0012, Aligned region: 537..565
AAA_25 [PF13481], Evalue: 0.0013, Aligned region: 92..129
AAA_25 [PF13481], Evalue: 0.0013, Aligned region: 262..295
AAA_25 [PF13481], Evalue: 0.0013, Aligned region: 532..557
T2SE [PF00437], Evalue: 0.0029, Aligned region: 260..287
T2SE [PF00437], Evalue: 0.0029, Aligned region: 536..569
MMR_HSR1 [PF01926], Evalue: 0.0039, Aligned region: 264..293
MMR_HSR1 [PF01926], Evalue: 0.0039, Aligned region: 540..557
PduV-EutP [PF10662], Evalue: 0.008, Aligned region: 263..283
PduV-EutP [PF10662], Evalue: 0.008, Aligned region: 539..558
Arch_ATPase [PF01637], Evalue: 0.0093, Aligned region: 261..289
Arch_ATPase [PF01637], Evalue: 0.0093, Aligned region: 538..560
AAA_10 [PF12846], Evalue: 0.0098, Aligned region: 264..287
AAA_10 [PF12846], Evalue: 0.0098, Aligned region: 539..577
Protein Sequence: 1123 a.a.     [Download]
>gi|338536040|ref|YP_004669374.1| unnamed protein product [Myxococcus fulvus HW-1]
MQRHVSGRVTLTPLALRHLAVHADTLEAAVEELTLALDDQLSRVHPRRVPEFIRPTEGTLHPLTVPAIPV
WGETETELAPLSLSTVVAPTLQSFVGLHAPRLEAHLWFQATELPADTVERLAERLDGMSDALRLSLRPDD
AESLMDIEVRATPTALAALTPRELHRDLRPPPRPPDVPAEPDAAERDDDDEDALDQDTWEPRRRSHPRDA
GSRPTTPPPTPTLDSVGVPWHRLAQEGQLDAAHEQDALVALLRARLGARDAEAVVLVGPSGVGKTSVLHA
LAQALRAPTASEADKARPFYFLDGSRLIAGEGFAGDWQQQVLRAFREATEARALLSLGHAVELLDAGKSA
HSDENVAQLLLPLLATREVAVVAEATEETWAQVERRNTSFARLFSVVRVAEPSPEALTRILAKVAEDEAT
SALEVRAEALDEARFLCRRFLPYGAQVGNAVAFLRRLMDSSAQASRPVVTRLEAIRQFASESGIPEALLR
DDVPLDAAQVRAFLSARVLGQDAAVERAASVVSVLKAGLADVRRPLGVLLFVGPTGVGKTELSKALAELL
FGAKERMVRLDMGEYAGPDALLRLLGDGETPGHLSSAVRRQPFCVVLLDEVEKAHPAVHDALLGVLGEGR
LTDASGRFTDFRNALIILTSNLGADTLRARVGFDASGGAPDLAGLRAHYLAEVQRFFRPELFNRLDDVVV
FSPLSEALLRRLVVREVDAVCRRPGLSLHDAVLEVTPAAQDWLAVRGFDARYGARPLKRALERELVVPVS
DWLAAHPRGSPARLTVDAGEKGLHLRAERVGGEAEGVGREAIERILEDAATVRAEVQRWSRCPPMVSLRR
GLSVFDKVSRQAAFWEERELAEADARKSSEARELDKALLACVQQAEAIEDLLFEAHLSRAVEQADSLRRE
VRQLKATFERVRERIYTSLFPHTRGATLCLVPGRGAWSKVRLLAAAYETWAEQNGLEKKRCLLTVPARKP
GEKGPRTQQPPQWRWADKEDLDKLEVQPLAYALQVKGGASALRLAGEHGMHRFIEGSQVSMVHADFVPQA
HVPVTLFPLETLQQRRPRKEIRQVRLSGSGTGEGTLMDLRTGVQQRFGPGGLALEPLMAPWMQWRVFNGQ
HED
 
Nucleotide Sequence: 3372 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7885878-7889249 Myxococcus fulvus HW-1 chromosome, complete genome
TTGCAGCGGCACGTCAGCGGCCGGGTGACGCTCACGCCGCTGGCCCTGCGCCACCTGGCGGTCCACGCGG
ACACGCTGGAGGCCGCGGTGGAAGAGCTGACGCTCGCGCTGGACGACCAGCTCTCCCGCGTCCACCCCCG
GCGGGTGCCGGAGTTCATCCGCCCCACCGAGGGGACACTCCACCCGCTGACCGTCCCCGCGATTCCCGTC
TGGGGCGAGACGGAGACCGAGCTCGCGCCGCTGTCGCTGTCCACCGTGGTCGCCCCCACCCTCCAGTCCT
TCGTGGGCCTCCACGCGCCTCGGCTGGAGGCCCACCTGTGGTTCCAGGCCACGGAGCTCCCGGCCGACAC
CGTGGAGCGGCTGGCGGAGCGCCTGGACGGGATGTCCGACGCCCTCCGCCTCTCGCTGCGCCCGGATGAC
GCCGAGTCCCTGATGGACATCGAGGTGCGGGCCACGCCGACGGCGCTCGCGGCCCTCACCCCCCGCGAGC
TGCACCGCGACCTCCGCCCGCCGCCCCGCCCGCCTGACGTGCCCGCGGAGCCGGATGCCGCCGAACGGGA
TGACGACGACGAAGACGCGCTCGACCAGGACACCTGGGAGCCACGCCGCCGCTCCCACCCGCGCGACGCG
GGGAGCCGTCCCACGACGCCGCCGCCCACGCCCACGCTGGACAGCGTCGGCGTGCCCTGGCACCGGCTGG
CGCAGGAAGGGCAGCTCGACGCGGCCCACGAACAGGACGCCCTGGTGGCGCTGCTGCGCGCCCGGCTCGG
CGCCAGGGACGCGGAGGCCGTGGTGCTGGTGGGGCCTTCGGGCGTGGGCAAGACGTCGGTGTTGCACGCG
CTCGCCCAGGCGCTGCGCGCGCCCACCGCGAGCGAGGCCGACAAGGCCCGCCCCTTCTACTTCCTGGACG
GGAGCCGCCTCATCGCCGGCGAGGGCTTCGCGGGGGACTGGCAGCAGCAGGTGCTGCGCGCCTTCCGGGA
AGCCACCGAGGCCCGGGCCCTGCTCTCCCTGGGCCACGCGGTGGAGCTGCTGGACGCGGGCAAGAGCGCG
CACAGCGATGAGAACGTGGCCCAGTTGCTGCTGCCGCTGCTCGCGACGCGCGAGGTGGCCGTCGTGGCCG
AGGCCACGGAGGAGACGTGGGCCCAGGTGGAGCGGCGCAACACGAGCTTCGCCCGGCTCTTCTCCGTGGT
GCGCGTCGCGGAGCCCTCGCCGGAGGCCCTCACCCGCATCCTCGCGAAGGTGGCGGAGGACGAGGCCACC
AGCGCCCTGGAGGTCCGCGCGGAAGCGCTCGATGAAGCGCGCTTCCTCTGCCGCCGCTTCCTGCCCTACG
GCGCCCAGGTGGGCAACGCCGTGGCCTTCCTGCGCCGGTTGATGGACTCCAGCGCGCAGGCCTCGCGCCC
CGTCGTCACGCGCCTGGAGGCCATCCGGCAGTTCGCCTCCGAGTCGGGCATCCCGGAAGCCCTGCTCCGC
GACGACGTGCCCCTGGACGCGGCGCAGGTGCGCGCCTTCCTCTCCGCCCGCGTGCTGGGCCAGGACGCCG
CCGTGGAGCGCGCCGCCTCGGTGGTCTCCGTCCTCAAGGCGGGCCTGGCGGATGTGCGGCGCCCGCTGGG
CGTCCTCCTCTTCGTGGGCCCCACGGGCGTGGGCAAGACGGAGCTGTCCAAGGCGCTGGCGGAGCTGCTC
TTCGGCGCGAAGGAGCGCATGGTCCGCCTGGACATGGGGGAGTACGCCGGCCCGGACGCGCTGCTGCGGC
TGTTGGGAGATGGCGAGACGCCCGGCCACCTCTCCTCCGCGGTGCGCCGTCAGCCCTTCTGCGTGGTGCT
GCTGGACGAGGTGGAGAAGGCCCACCCCGCCGTGCATGACGCGCTGCTGGGCGTGCTGGGCGAGGGCCGC
CTCACGGACGCCTCCGGCCGCTTCACCGACTTCCGCAACGCGCTCATCATCCTCACCAGCAACCTGGGCG
CGGACACGCTGCGCGCTCGCGTGGGCTTCGACGCCTCGGGTGGCGCGCCCGACCTGGCCGGCCTCCGCGC
GCACTACCTCGCCGAGGTGCAGCGGTTCTTCCGGCCGGAGCTGTTCAACCGGCTGGATGACGTGGTGGTC
TTCTCCCCCCTGTCGGAGGCCTTGCTGCGCCGCCTGGTGGTGCGCGAGGTGGACGCCGTGTGCCGCCGCC
CGGGCCTCTCCCTGCACGACGCGGTGCTGGAGGTGACCCCCGCCGCGCAGGACTGGCTCGCCGTGCGCGG
CTTCGACGCGCGCTATGGCGCCCGGCCGCTGAAGCGCGCGCTGGAGCGGGAGCTGGTGGTGCCCGTCTCC
GACTGGCTCGCGGCCCATCCGCGCGGGAGCCCGGCGCGCCTCACGGTCGACGCCGGTGAGAAGGGGCTGC
ACCTGCGCGCGGAGCGCGTGGGCGGCGAGGCGGAGGGCGTGGGGCGGGAGGCCATCGAGCGCATCCTGGA
GGACGCGGCCACCGTCCGCGCGGAGGTGCAGCGCTGGAGCCGCTGCCCCCCCATGGTCTCCCTGCGGCGG
GGGCTGAGCGTCTTCGACAAGGTCTCCCGCCAGGCCGCCTTCTGGGAGGAGCGCGAGCTGGCGGAGGCAG
ACGCTCGCAAGTCTTCGGAGGCGCGCGAGCTGGACAAGGCCCTGCTGGCGTGTGTCCAGCAGGCGGAGGC
CATCGAGGACCTCCTCTTCGAGGCGCACCTGTCGCGCGCAGTGGAGCAGGCGGACTCCCTGCGCCGGGAG
GTGCGCCAGTTGAAGGCGACCTTCGAGCGCGTCCGGGAGCGCATCTACACCTCCCTCTTCCCGCATACAC
GCGGCGCGACGCTCTGCCTGGTGCCGGGACGCGGCGCCTGGAGCAAGGTGCGCCTGCTGGCGGCGGCCTA
CGAGACGTGGGCCGAGCAGAACGGCCTGGAGAAGAAGCGCTGCCTGCTCACCGTCCCCGCGCGCAAGCCC
GGCGAAAAGGGGCCTCGCACGCAGCAGCCACCCCAGTGGCGCTGGGCGGACAAGGAGGACCTCGACAAGC
TCGAGGTGCAGCCCTTGGCCTACGCGCTCCAGGTCAAGGGAGGCGCGTCGGCGCTGCGGCTCGCCGGTGA
GCACGGGATGCACCGCTTCATCGAGGGCAGTCAGGTTTCGATGGTGCACGCCGACTTCGTGCCCCAGGCG
CACGTGCCGGTGACGCTCTTCCCCCTGGAGACGCTCCAGCAGCGGCGGCCCCGGAAGGAGATCCGCCAGG
TGCGCCTGTCTGGCAGCGGCACCGGCGAGGGCACGCTGATGGACCTCCGCACGGGCGTCCAGCAGCGCTT
CGGGCCCGGCGGCCTGGCGCTGGAGCCGCTGATGGCGCCGTGGATGCAGTGGCGCGTCTTCAACGGCCAA
CACGAGGACTGA