SecReT6
Protein ID: 338536041
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_32080
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7889254..7892667 [+]
ProductClpA/B family protein
NoteTssH
UniProt IDF8C9L8
KEGG IDmfu:LILAB_32080
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-34, Aligned region: 255..290
AAA_2 [PF07724], Evalue: 1.10E-34, Aligned region: 532..690
AAA [PF00004], Evalue: 1.30E-16, Aligned region: 257..351
AAA [PF00004], Evalue: 1.30E-16, Aligned region: 537..628
AAA [PF00004], Evalue: 1.30E-16, Aligned region: 858..890
AAA_5 [PF07728], Evalue: 6.80E-15, Aligned region: 256..284
AAA_5 [PF07728], Evalue: 6.80E-15, Aligned region: 537..648
ClpB_D2-small [PF10431], Evalue: 4.20E-14, Aligned region: 697..772
AAA_16 [PF13191], Evalue: 9.70E-09, Aligned region: 233..358
AAA_16 [PF13191], Evalue: 9.70E-09, Aligned region: 522..572
AAA_16 [PF13191], Evalue: 9.70E-09, Aligned region: 783..855
AAA_16 [PF13191], Evalue: 9.70E-09, Aligned region: 954..1049
AAA_17 [PF13207], Evalue: 3.60E-08, Aligned region: 257..317
AAA_17 [PF13207], Evalue: 3.60E-08, Aligned region: 537..687
AAA_17 [PF13207], Evalue: 3.60E-08, Aligned region: 891..919
AAA_22 [PF13401], Evalue: 8.00E-08, Aligned region: 253..292
AAA_22 [PF13401], Evalue: 8.00E-08, Aligned region: 537..578
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 252..390
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 537..565
Zeta_toxin [PF06414], Evalue: 1.40E-06, Aligned region: 254..280
Zeta_toxin [PF06414], Evalue: 1.40E-06, Aligned region: 528..572
AAA_19 [PF13245], Evalue: 2.30E-06, Aligned region: 245..282
AAA_19 [PF13245], Evalue: 2.30E-06, Aligned region: 539..558
AAA_33 [PF13671], Evalue: 1.30E-05, Aligned region: 256..292
AAA_33 [PF13671], Evalue: 1.30E-05, Aligned region: 537..558
MobB [PF03205], Evalue: 1.80E-05, Aligned region: 256..281
MobB [PF03205], Evalue: 1.80E-05, Aligned region: 537..561
ABC_tran [PF00005], Evalue: 4.00E-05, Aligned region: 251..273
ABC_tran [PF00005], Evalue: 4.00E-05, Aligned region: 535..556
Arch_ATPase [PF01637], Evalue: 0.00018, Aligned region: 235..279
Arch_ATPase [PF01637], Evalue: 0.00018, Aligned region: 536..554
Arch_ATPase [PF01637], Evalue: 0.00018, Aligned region: 602..613
AAA_18 [PF13238], Evalue: 0.00019, Aligned region: 257..296
AAA_18 [PF13238], Evalue: 0.00019, Aligned region: 538..560
AAA_14 [PF13173], Evalue: 0.00033, Aligned region: 254..278
AAA_14 [PF13173], Evalue: 0.00033, Aligned region: 537..674
AAA_29 [PF13555], Evalue: 0.00042, Aligned region: 252..270
AAA_29 [PF13555], Evalue: 0.00042, Aligned region: 535..561
NACHT [PF05729], Evalue: 0.00051, Aligned region: 256..282
NACHT [PF05729], Evalue: 0.00051, Aligned region: 536..580
Sigma54_activat [PF00158], Evalue: 0.00084, Aligned region: 254..273
Sigma54_activat [PF00158], Evalue: 0.00084, Aligned region: 534..661
DUF258 [PF03193], Evalue: 0.00089, Aligned region: 253..277
DUF258 [PF03193], Evalue: 0.00089, Aligned region: 534..554
AAA_3 [PF07726], Evalue: 0.0012, Aligned region: 538..649
AAA_24 [PF13479], Evalue: 0.0016, Aligned region: 256..291
AAA_24 [PF13479], Evalue: 0.0016, Aligned region: 536..558
RNA_helicase [PF00910], Evalue: 0.0017, Aligned region: 257..281
RNA_helicase [PF00910], Evalue: 0.0017, Aligned region: 537..558
AAA_10 [PF12846], Evalue: 0.0019, Aligned region: 256..280
AAA_10 [PF12846], Evalue: 0.0019, Aligned region: 536..574
AAA_23 [PF13476], Evalue: 0.0027, Aligned region: 257..270
AAA_23 [PF13476], Evalue: 0.0027, Aligned region: 536..576
TrwB_AAD_bind [PF10412], Evalue: 0.0028, Aligned region: 249..283
TrwB_AAD_bind [PF10412], Evalue: 0.0028, Aligned region: 535..569
AAA_25 [PF13481], Evalue: 0.0029, Aligned region: 252..283
AAA_25 [PF13481], Evalue: 0.0029, Aligned region: 312..352
AAA_25 [PF13481], Evalue: 0.0029, Aligned region: 535..587
AAA_25 [PF13481], Evalue: 0.0029, Aligned region: 840..888
SRP54 [PF00448], Evalue: 0.0035, Aligned region: 255..279
SRP54 [PF00448], Evalue: 0.0035, Aligned region: 535..557
ResIII [PF04851], Evalue: 0.005, Aligned region: 248..277
ResIII [PF04851], Evalue: 0.005, Aligned region: 508..557
AAA_28 [PF13521], Evalue: 0.0058, Aligned region: 128..159
AAA_28 [PF13521], Evalue: 0.0058, Aligned region: 257..272
AAA_28 [PF13521], Evalue: 0.0058, Aligned region: 537..560
AAA_28 [PF13521], Evalue: 0.0058, Aligned region: 702..724
Protein Sequence: 1137 a.a.     [Download]
>gi|338536041|ref|YP_004669375.1| unnamed protein product [Myxococcus fulvus HW-1]
MDLRLPFVVAPRGGRLVEAWVPAFFPALHKVGPSLSTLRDELALAVMERFEREPASRLAQYQLPPHFALK
QVTVGAEARDREKARNILLEGNMTVLLEKWPRDTFWVVTPTRLPEARFALSEPAALPQALARRLVAWCLE
HGLDSLDEQWTQGRERLELLEVDAYAPTILPRTPPRPRTPRRRKPRTPAKEETAPETPEQREARRNRRRL
SLVELRAVARNLSHGARDDTLERCFGREALVCELVEALEGREGSALVLVGPSGAGKTALIHEAVRRLTAR
QEAAGTRRDVWRVDGNQFIAGMMYVGQWEARARGVVNELMEVGDLLYVDDLASLVYAGRTRNERTNVAQF
LEPHMARGELTVLAESTPERFERVREEAPTLASLFRVIHVPALDARATLPALLGTLRELEAESADSSVRL
SPVALETLLTLQQRFVSHEAFPGKAVRLLRRVLAREGSVEAGTRRLTTGDVIAAMREQTGLPDFVLGSAQ
PKTREALGWELGRQVAGQPEAVAAVTDAILTLQAALQPPDKPLATYLFVGPTGVGKTETAKALARTLFGG
EQRLVRFDMSEFVTSASITRLLGRPGAPDGELTTALRTQPFCVVLFDEVEKAHPRVFDALLQFLGEGRLT
DGAGRTVDARQSVVVLTSNLGVREAATHTGFHRTADSAEVHYLSAVRAYFRPEFFNRLDRVVPFRPLTPA
ALRVVVDHALEALLSRHGIRRGNVLVEVEPRLLDLLVEEAYDPRYGARPLKRALEKRLTLPLAHHLVRRG
ADDLARVELLRDGDALRVCVELLVNAPAWPPEPPVSSWTLAKISTELTALSARLESLMAAAEAARAAGAE
GSVEERELLERLHRLRLEATDIQENELVSRDFEDSESRVTKVMRQVTSHAHHVGHLGLRHRPVYQERPLP
VSREEQLRRSRPRVLSLRDEVAWTEHQLASRERGPDVITVLAEGLGDATPSAVWTAANSLPTALAETTVF
LEAVHADGRVEWFSGSDERSDDLELRRVVVRLSGLGLREVMAPLQGYALVELDQGASTRPVLVRLEHLAG
AVTDLGDVAREVAARDALRGAERAALRAGTTSADAPRYVILRGYEGIMSWREGHTTTELLHVASGVHPTK
AHAWAARVLRGSGPRHD
 
Nucleotide Sequence: 3414 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7889254-7892667 Myxococcus fulvus HW-1 chromosome, complete genome
ATGGACCTGAGACTTCCCTTCGTGGTGGCGCCGCGCGGCGGCCGGCTCGTGGAGGCGTGGGTGCCCGCCT
TCTTCCCCGCGCTGCACAAGGTGGGGCCCAGCCTCTCCACGCTGCGGGACGAACTGGCGCTCGCCGTCAT
GGAGCGCTTCGAACGCGAGCCCGCGTCGCGCCTGGCGCAGTACCAGCTTCCCCCGCACTTCGCCCTGAAG
CAGGTGACCGTCGGCGCGGAGGCCCGCGACCGGGAGAAGGCCCGGAACATCCTCCTCGAAGGCAACATGA
CGGTGCTGCTGGAGAAGTGGCCCCGTGACACCTTCTGGGTCGTCACCCCCACCCGCCTGCCCGAGGCGCG
CTTCGCGCTGAGCGAACCGGCGGCCCTGCCCCAGGCGCTCGCGCGCCGGCTGGTGGCGTGGTGCCTGGAG
CACGGGCTCGACTCCCTGGACGAACAGTGGACCCAGGGCCGGGAGCGGCTGGAGCTCCTGGAGGTGGACG
CCTATGCCCCCACCATCCTTCCCCGCACGCCGCCCCGGCCGCGGACGCCGCGCCGCCGCAAGCCGCGCAC
GCCCGCGAAGGAGGAGACCGCCCCCGAGACACCCGAGCAGCGCGAGGCCCGCCGCAACCGCCGCCGCCTG
TCGCTGGTGGAGCTGCGCGCCGTGGCCCGGAACCTGAGCCACGGGGCCCGGGACGACACCTTGGAGCGCT
GCTTCGGCCGCGAGGCGCTGGTGTGCGAGCTGGTGGAGGCGCTCGAAGGCCGCGAGGGCTCCGCGCTGGT
GCTGGTGGGCCCGTCGGGCGCGGGAAAGACGGCGCTCATCCACGAGGCCGTGCGGCGCCTCACCGCCCGG
CAGGAAGCCGCGGGCACGCGCCGCGACGTGTGGCGCGTGGACGGCAACCAGTTCATCGCGGGGATGATGT
ACGTGGGCCAGTGGGAGGCCCGTGCCCGCGGCGTGGTGAACGAGCTGATGGAGGTCGGCGACCTGCTCTA
CGTGGACGACCTGGCGTCGCTCGTCTACGCGGGGCGCACGCGCAACGAGCGCACCAACGTGGCGCAGTTC
CTGGAGCCGCACATGGCCCGGGGCGAGCTGACGGTGCTCGCCGAGTCCACCCCGGAGCGCTTCGAGCGCG
TGCGGGAAGAAGCGCCGACGCTCGCGTCCTTGTTCCGCGTCATCCACGTGCCCGCCCTGGACGCGCGCGC
CACGCTGCCCGCGCTGCTGGGGACGCTGCGCGAGCTGGAGGCCGAGAGCGCGGACAGCAGCGTGCGGCTG
TCGCCCGTGGCCCTGGAGACCTTGCTGACCCTGCAGCAGCGCTTCGTGTCGCACGAGGCGTTTCCGGGGA
AGGCGGTCCGCCTGCTGCGCCGGGTCCTCGCCCGCGAAGGCAGCGTGGAGGCCGGCACGCGCCGGCTGAC
GACGGGGGACGTCATCGCGGCGATGCGCGAGCAGACGGGCCTGCCGGACTTCGTCCTGGGCAGCGCCCAG
CCGAAGACGCGCGAGGCGCTGGGCTGGGAGCTGGGACGCCAGGTGGCGGGCCAGCCCGAGGCCGTGGCCG
CCGTGACGGATGCCATCCTCACGCTCCAGGCCGCGCTCCAGCCCCCCGACAAGCCGCTGGCCACCTACCT
CTTCGTGGGCCCCACGGGCGTGGGCAAGACGGAGACGGCGAAGGCCCTGGCGCGGACGCTCTTTGGTGGC
GAGCAGCGGCTGGTCCGCTTCGACATGTCGGAGTTCGTCACGTCGGCCAGCATCACCCGGCTGCTCGGCA
GGCCCGGCGCGCCGGATGGCGAGCTGACCACGGCCCTGCGCACCCAGCCCTTCTGCGTGGTGCTGTTCGA
CGAGGTGGAGAAGGCCCACCCGCGCGTGTTCGACGCCCTCCTCCAGTTCCTCGGCGAGGGGCGCCTCACG
GATGGCGCGGGCCGCACCGTGGACGCGCGCCAGTCCGTCGTCGTGCTCACCAGCAACCTGGGCGTGCGCG
AGGCCGCCACCCATACCGGCTTCCACCGCACCGCGGACAGCGCGGAGGTCCACTACCTGTCCGCCGTGCG
CGCGTACTTCCGCCCGGAGTTCTTCAACCGGCTGGACCGGGTGGTGCCCTTCCGCCCGCTGACGCCCGCC
GCGCTGCGCGTGGTGGTGGACCACGCGCTCGAAGCCCTCCTGTCACGCCACGGCATCCGCCGCGGCAACG
TCCTGGTAGAGGTGGAGCCGCGCCTGTTGGACCTGCTGGTGGAGGAGGCCTACGACCCGCGCTACGGCGC
CCGGCCCCTCAAGCGCGCGCTGGAGAAGCGCCTGACGCTGCCGCTGGCCCACCACCTGGTCCGGCGGGGC
GCGGACGACCTGGCCCGCGTGGAGCTGCTTCGGGACGGCGACGCGCTGCGCGTCTGCGTGGAGCTGCTGG
TCAACGCCCCCGCCTGGCCCCCCGAGCCGCCTGTGTCCTCCTGGACGCTGGCGAAAATCTCCACCGAGCT
GACGGCGCTCTCCGCGCGCCTGGAGTCCTTGATGGCGGCTGCGGAGGCGGCGCGCGCGGCCGGCGCCGAG
GGCTCCGTGGAGGAGCGGGAGCTCCTCGAGCGGCTGCACCGGCTGAGGCTCGAGGCCACCGACATCCAGG
AGAACGAGCTGGTGTCGCGCGACTTCGAGGACTCGGAGTCGCGGGTGACCAAGGTGATGCGTCAGGTGAC
CTCCCACGCCCACCACGTGGGCCATCTGGGGCTGCGTCACCGCCCCGTCTACCAGGAGCGTCCCCTGCCC
GTGTCGCGGGAGGAGCAGCTTCGCCGCTCGCGGCCCCGGGTGCTGTCCCTGCGGGACGAGGTGGCCTGGA
CCGAGCACCAGCTCGCGAGCCGGGAGCGCGGCCCCGACGTCATCACCGTGCTGGCGGAAGGACTGGGAGA
CGCCACGCCCTCCGCCGTCTGGACCGCGGCCAACTCCCTCCCCACGGCCCTGGCGGAGACCACCGTGTTC
CTGGAAGCCGTCCACGCGGACGGGCGCGTCGAGTGGTTCTCGGGCAGTGACGAGCGCTCGGACGACCTGG
AGCTGCGGCGCGTCGTGGTGCGGCTGTCGGGCCTGGGCCTGCGGGAGGTGATGGCGCCCCTGCAGGGCTA
TGCCCTGGTGGAGCTCGACCAGGGAGCTTCGACGCGGCCGGTGCTGGTGCGTCTGGAGCACCTGGCTGGC
GCCGTGACGGACCTGGGCGATGTGGCTCGCGAGGTGGCGGCGCGGGACGCGCTCCGCGGCGCCGAGCGAG
CGGCGCTCAGGGCGGGGACCACGTCAGCCGACGCCCCCCGCTACGTCATCCTGCGAGGCTACGAGGGCAT
CATGTCCTGGAGAGAGGGCCACACCACGACGGAGCTCCTGCACGTCGCCAGCGGAGTCCACCCCACCAAG
GCCCACGCCTGGGCGGCACGGGTGCTCCGAGGCTCCGGCCCGAGGCACGACTGA