SecReT6
Protein ID: 338536042
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_32085
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7892669..7894963 [+]
ProductClpA/B family protein
NoteTssH
UniProt IDF8C9L9
KEGG IDmfu:LILAB_32085
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.90E-34, Aligned region: 232..296
AAA_2 [PF07724], Evalue: 5.90E-34, Aligned region: 323..339
AAA_2 [PF07724], Evalue: 5.90E-34, Aligned region: 501..661
AAA [PF00004], Evalue: 7.50E-16, Aligned region: 234..339
AAA [PF00004], Evalue: 7.50E-16, Aligned region: 507..582
ClpB_D2-small [PF10431], Evalue: 3.50E-15, Aligned region: 668..743
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 214..396
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 492..542
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 568..594
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 661..687
AAA_5 [PF07728], Evalue: 7.50E-08, Aligned region: 233..255
AAA_5 [PF07728], Evalue: 7.50E-08, Aligned region: 506..618
Sigma54_activat [PF00158], Evalue: 2.80E-06, Aligned region: 222..257
Sigma54_activat [PF00158], Evalue: 2.80E-06, Aligned region: 506..602
AAA_22 [PF13401], Evalue: 2.90E-05, Aligned region: 231..262
AAA_22 [PF13401], Evalue: 2.90E-05, Aligned region: 505..527
IstB_IS21 [PF01695], Evalue: 5.30E-05, Aligned region: 216..255
IstB_IS21 [PF01695], Evalue: 5.30E-05, Aligned region: 506..525
AAA_19 [PF13245], Evalue: 0.00015, Aligned region: 224..256
AAA_19 [PF13245], Evalue: 0.00015, Aligned region: 323..355
AAA_19 [PF13245], Evalue: 0.00015, Aligned region: 378..415
AAA_19 [PF13245], Evalue: 0.00015, Aligned region: 505..540
AAA_25 [PF13481], Evalue: 0.00028, Aligned region: 232..340
AAA_25 [PF13481], Evalue: 0.00028, Aligned region: 502..568
Arch_ATPase [PF01637], Evalue: 0.00041, Aligned region: 214..258
Arch_ATPase [PF01637], Evalue: 0.00041, Aligned region: 507..518
AAA_28 [PF13521], Evalue: 0.0024, Aligned region: 234..263
AAA_28 [PF13521], Evalue: 0.0024, Aligned region: 346..367
AAA_28 [PF13521], Evalue: 0.0024, Aligned region: 506..536
Hpr_kinase_C [PF07475], Evalue: 0.0025, Aligned region: 234..256
Hpr_kinase_C [PF07475], Evalue: 0.0025, Aligned region: 507..524
T2SE [PF00437], Evalue: 0.004, Aligned region: 226..256
T2SE [PF00437], Evalue: 0.004, Aligned region: 498..532
AAA_30 [PF13604], Evalue: 0.0054, Aligned region: 221..258
AAA_30 [PF13604], Evalue: 0.0054, Aligned region: 506..549
TIP49 [PF06068], Evalue: 0.0055, Aligned region: 228..272
TIP49 [PF06068], Evalue: 0.0055, Aligned region: 505..531
IPT [PF01745], Evalue: 0.008, Aligned region: 235..254
IPT [PF01745], Evalue: 0.008, Aligned region: 283..305
IPT [PF01745], Evalue: 0.008, Aligned region: 333..344
IPT [PF01745], Evalue: 0.008, Aligned region: 505..544
AAA_14 [PF13173], Evalue: 0.0094, Aligned region: 233..254
AAA_14 [PF13173], Evalue: 0.0094, Aligned region: 506..583
Protein Sequence: 764 a.a.     [Download]
>gi|338536042|ref|YP_004669376.1| unnamed protein product [Myxococcus fulvus HW-1]
MEKNVHLFVRHYPGVGVAAQVLTHPHLASFAPTLAAARLDLAAVVGRLLKRGELWDEETHWSDLRQRRMT
LTVRALDHGRMLPVPLRLTVLTHGMKSRAKGKGATEREKLRVWVPRVGVEGTLHDAADLEPFVKELVRHE
LYLAPLERLHALAYVGEEQVETLSVPASFRDTPRARATEVSKQPRRFAPPPGLAEASRCLNEEARAGLLE
RAWERNAEVSRLAEAVTAKARASVLLVGPASVGKTALVHELVQRAEAATAGTPLHGVEFYSSSGGRIMAG
MRYLGQWQERVQRMVEALRVRRAVLHLDSLSELLSLGGGDTGLDVARHLLPALEGGEISLVLEATPEDVA
RAERTHGAFLQALRHLAVAPLAPMAAHAALQQAAQRVGRARKVRFTPESLERASELTERFGDGPPPGGAV
SLLRAASAGPNAAGDVDTASVTSAFCTRTGYPRELVDPAIRLDPDALLRRFRERVVGQDEATLLLRNLVV
TLKTGLADPTRPLGAFLLLGPTGVGKTESALALAEYLFADVARLARFDMAEYAAPGSAARLVGEAGGQQG
GLARRVREQPFGVVLLDEVEKADTGVHDLLLQVLGEGRLTDATGRTVSFRNTVVLLTSNLGADSAGRGLG
FGARGVQEQATHYLGAAAAFFRPELLNRLDRVVPYRALTEDVIAALARRALEAALAREGLSRRGVKVTFG
EDVVKHLARTGFDARYGARPLKRAVEQQVVAPLARWLAAQATRAPPQVVLRVGTEGRIALSGLE
 
Nucleotide Sequence: 2295 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7892669-7894963 Myxococcus fulvus HW-1 chromosome, complete genome
ATGGAAAAGAACGTCCACCTCTTCGTGCGCCACTACCCGGGCGTGGGCGTGGCGGCCCAGGTCCTCACCC
ACCCGCACCTGGCGTCCTTCGCGCCCACCCTGGCCGCCGCGCGGCTCGACCTCGCGGCGGTGGTGGGCCG
GCTCCTCAAGCGCGGTGAGCTCTGGGACGAGGAGACGCACTGGAGCGACCTGCGCCAACGGCGGATGACG
CTCACGGTGCGCGCGCTCGACCATGGCCGGATGCTCCCGGTGCCGCTGCGCCTCACGGTGCTCACCCATG
GCATGAAGTCCCGCGCCAAGGGCAAGGGCGCCACGGAGCGCGAGAAGCTGCGCGTGTGGGTGCCCCGCGT
CGGCGTCGAGGGCACGCTGCATGACGCAGCGGACCTGGAGCCCTTCGTCAAGGAGCTGGTCCGTCACGAG
CTGTACCTGGCGCCCCTGGAGCGCCTTCACGCCCTGGCCTACGTGGGTGAGGAGCAGGTGGAGACGCTGT
CGGTGCCCGCCAGCTTCCGAGACACCCCTCGCGCGCGCGCCACGGAGGTCTCGAAGCAGCCGCGCCGCTT
TGCCCCACCGCCGGGGCTCGCGGAGGCCAGCCGGTGCCTCAACGAGGAGGCGCGCGCCGGGCTGCTGGAG
CGGGCCTGGGAGCGGAACGCGGAGGTGTCCCGCCTGGCGGAGGCCGTCACCGCGAAGGCCCGCGCCAGCG
TGCTCCTGGTGGGCCCCGCGTCCGTGGGGAAGACGGCCCTGGTGCATGAGCTGGTGCAGCGCGCGGAGGC
GGCCACCGCGGGCACCCCGCTCCACGGCGTGGAGTTCTACAGCTCGTCGGGCGGGCGCATCATGGCTGGC
ATGCGCTACCTGGGGCAGTGGCAGGAGCGCGTCCAGCGCATGGTGGAGGCCCTGCGCGTGCGCCGCGCGG
TGCTCCACCTGGACAGCCTGTCGGAGCTGCTGTCCCTGGGCGGCGGTGACACCGGCCTGGACGTGGCGCG
CCACCTGCTCCCCGCGCTGGAGGGCGGTGAGATTTCCCTCGTGCTGGAGGCCACCCCCGAGGACGTGGCC
CGCGCGGAGCGGACCCACGGCGCCTTCCTTCAAGCGCTGCGGCACCTCGCGGTGGCCCCGCTGGCGCCCA
TGGCCGCGCACGCCGCGCTCCAGCAGGCCGCGCAGCGCGTGGGCCGCGCCCGCAAGGTGCGCTTCACCCC
CGAGTCCCTGGAGCGCGCCAGCGAGCTCACGGAGCGCTTCGGCGACGGGCCTCCGCCGGGCGGCGCCGTG
TCACTGCTCCGCGCCGCCAGCGCGGGCCCCAACGCGGCGGGAGACGTGGACACCGCGTCGGTGACGAGCG
CCTTCTGCACTCGCACCGGCTATCCCCGCGAGCTGGTGGACCCCGCCATCCGGTTGGACCCGGACGCCCT
GCTGCGCCGCTTCCGCGAGCGCGTCGTCGGCCAGGACGAAGCCACCCTGCTCCTGCGCAACCTGGTCGTC
ACCCTGAAGACGGGGCTGGCCGACCCCACCCGCCCGCTGGGCGCCTTCCTCCTGCTGGGCCCCACGGGCG
TGGGCAAGACGGAGTCGGCGCTCGCACTGGCGGAGTACCTGTTCGCCGACGTCGCCCGGCTGGCGCGCTT
CGACATGGCGGAGTACGCCGCGCCCGGGAGCGCCGCGCGACTGGTGGGCGAAGCCGGAGGCCAGCAAGGC
GGGCTCGCCCGGCGGGTGCGCGAACAGCCCTTCGGCGTGGTGCTGCTGGACGAGGTGGAGAAGGCGGACA
CGGGCGTCCATGACCTGCTGTTGCAGGTGCTGGGCGAAGGCCGGCTCACGGACGCCACGGGCCGCACCGT
CAGCTTCCGCAACACCGTGGTGCTGCTCACCAGCAACCTGGGCGCGGACAGCGCGGGGCGCGGACTGGGC
TTCGGAGCGCGCGGCGTCCAGGAGCAGGCAACGCACTACCTGGGGGCCGCGGCGGCCTTCTTCCGGCCCG
AGCTGCTGAACCGCCTGGACCGGGTGGTGCCGTACCGCGCGCTCACGGAGGACGTCATCGCAGCACTCGC
CCGGCGCGCGCTGGAGGCGGCCCTCGCCCGCGAGGGGCTCAGCCGCCGCGGCGTGAAGGTGACGTTTGGC
GAGGACGTGGTGAAGCACCTGGCGCGCACCGGCTTCGACGCGCGCTATGGGGCCAGGCCCCTGAAGCGCG
CCGTGGAGCAACAGGTGGTCGCGCCCCTGGCGCGGTGGCTGGCGGCTCAGGCCACCCGCGCTCCGCCCCA
GGTGGTGCTCCGCGTGGGCACCGAGGGGCGGATTGCGTTGAGCGGCCTCGAGTGA