SecReT6
Protein ID: 338536048
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_32115
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7899758..7902412 [-]
ProductATP-dependent Clp protease, ATP-binding subunit ClpC
NoteTssH
UniProt IDF8C9M5
KEGG IDmfu:LILAB_32115
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.40E-57, Aligned region: 272..355
AAA_2 [PF07724], Evalue: 3.40E-57, Aligned region: 605..769
AAA [PF00004], Evalue: 9.40E-28, Aligned region: 273..404
AAA [PF00004], Evalue: 9.40E-28, Aligned region: 611..735
ClpB_D2-small [PF10431], Evalue: 6.20E-24, Aligned region: 776..854
Clp_N [PF02861], Evalue: 2.10E-22, Aligned region: 94..143
Clp_N [PF02861], Evalue: 2.10E-22, Aligned region: 166..217
AAA_5 [PF07728], Evalue: 3.00E-20, Aligned region: 273..352
AAA_5 [PF07728], Evalue: 3.00E-20, Aligned region: 398..494
AAA_5 [PF07728], Evalue: 3.00E-20, Aligned region: 610..731
AAA_16 [PF13191], Evalue: 2.40E-13, Aligned region: 194..222
AAA_16 [PF13191], Evalue: 2.40E-13, Aligned region: 250..295
AAA_16 [PF13191], Evalue: 2.40E-13, Aligned region: 311..351
AAA_16 [PF13191], Evalue: 2.40E-13, Aligned region: 387..470
AAA_16 [PF13191], Evalue: 2.40E-13, Aligned region: 582..646
AAA_16 [PF13191], Evalue: 2.40E-13, Aligned region: 676..705
AAA_22 [PF13401], Evalue: 3.30E-10, Aligned region: 192..226
AAA_22 [PF13401], Evalue: 3.30E-10, Aligned region: 270..353
AAA_22 [PF13401], Evalue: 3.30E-10, Aligned region: 608..704
Sigma54_activat [PF00158], Evalue: 4.40E-10, Aligned region: 254..296
Sigma54_activat [PF00158], Evalue: 4.40E-10, Aligned region: 603..741
Arch_ATPase [PF01637], Evalue: 2.50E-08, Aligned region: 251..420
Arch_ATPase [PF01637], Evalue: 2.50E-08, Aligned region: 611..633
Arch_ATPase [PF01637], Evalue: 2.50E-08, Aligned region: 676..701
AAA_18 [PF13238], Evalue: 8.60E-08, Aligned region: 274..397
AAA_18 [PF13238], Evalue: 8.60E-08, Aligned region: 612..636
AAA_14 [PF13173], Evalue: 3.20E-07, Aligned region: 273..355
AAA_14 [PF13173], Evalue: 3.20E-07, Aligned region: 612..707
RuvB_N [PF05496], Evalue: 1.50E-06, Aligned region: 272..293
RuvB_N [PF05496], Evalue: 1.50E-06, Aligned region: 341..353
RuvB_N [PF05496], Evalue: 1.50E-06, Aligned region: 561..629
AAA_17 [PF13207], Evalue: 4.90E-06, Aligned region: 274..341
AAA_17 [PF13207], Evalue: 4.90E-06, Aligned region: 614..649
IstB_IS21 [PF01695], Evalue: 5.70E-06, Aligned region: 268..296
IstB_IS21 [PF01695], Evalue: 5.70E-06, Aligned region: 610..629
Mg_chelatase [PF01078], Evalue: 9.40E-05, Aligned region: 269..290
Mg_chelatase [PF01078], Evalue: 9.40E-05, Aligned region: 609..632
NACHT [PF05729], Evalue: 0.00015, Aligned region: 273..295
NACHT [PF05729], Evalue: 0.00015, Aligned region: 612..651
AAA_19 [PF13245], Evalue: 0.00015, Aligned region: 270..297
AAA_19 [PF13245], Evalue: 0.00015, Aligned region: 612..631
Zeta_toxin [PF06414], Evalue: 0.00024, Aligned region: 272..293
Zeta_toxin [PF06414], Evalue: 0.00024, Aligned region: 387..420
Zeta_toxin [PF06414], Evalue: 0.00024, Aligned region: 602..662
MMR_HSR1 [PF01926], Evalue: 0.00035, Aligned region: 273..348
MMR_HSR1 [PF01926], Evalue: 0.00035, Aligned region: 611..629
AAA_23 [PF13476], Evalue: 0.00054, Aligned region: 273..290
AAA_23 [PF13476], Evalue: 0.00054, Aligned region: 498..573
AAA_23 [PF13476], Evalue: 0.00054, Aligned region: 608..735
RNA_helicase [PF00910], Evalue: 0.00072, Aligned region: 274..296
RNA_helicase [PF00910], Evalue: 0.00072, Aligned region: 611..632
AAA_28 [PF13521], Evalue: 0.001, Aligned region: 273..347
AAA_28 [PF13521], Evalue: 0.001, Aligned region: 410..456
AAA_28 [PF13521], Evalue: 0.001, Aligned region: 610..630
AAA_3 [PF07726], Evalue: 0.0013, Aligned region: 274..293
AAA_3 [PF07726], Evalue: 0.0013, Aligned region: 680..728
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 254..292
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 610..629
AAA_29 [PF13555], Evalue: 0.0021, Aligned region: 268..290
AAA_29 [PF13555], Evalue: 0.0021, Aligned region: 608..636
ResIII [PF04851], Evalue: 0.0073, Aligned region: 257..295
ResIII [PF04851], Evalue: 0.0073, Aligned region: 336..354
ResIII [PF04851], Evalue: 0.0073, Aligned region: 582..631
AAA_25 [PF13481], Evalue: 0.0079, Aligned region: 273..311
AAA_25 [PF13481], Evalue: 0.0079, Aligned region: 503..551
AAA_25 [PF13481], Evalue: 0.0079, Aligned region: 590..628
ABC_tran [PF00005], Evalue: 0.0086, Aligned region: 273..293
ABC_tran [PF00005], Evalue: 0.0086, Aligned region: 612..633
AAA_24 [PF13479], Evalue: 0.0098, Aligned region: 273..288
AAA_24 [PF13479], Evalue: 0.0098, Aligned region: 610..632
Protein Sequence: 884 a.a.     [Download]
>gi|338536048|ref|YP_004669382.1| unnamed protein product [Myxococcus fulvus HW-1]
MANVCDLCHQRPATTRVTRVAGNRRTTESLCDVCSSQRSRFGRMGLGTSLFDQFFSDFGDEDFGGLSRSL
QQPVERYDITEAFSDETRRVLEGAFEAARGAGAASIDTEHLLVALAKDPLGRTALSRMKLDPARVAERAE
SELRRGKRPMERPELSPHAKRALELAYQEAYELGHSYVGPEHVLLGLLQEGEGLASELLRELGAQHGKAR
ASVAESLAPSSEARRSPTPTLDEYCRDLTSLASEGKLDPVVGRANEIETTLEILSRRTKNNPVLIGEPGV
GKTAIVEGIAQRIISAAVPDTLRDKRVLQLDLSGLLAGSKYRGEFEERLKKVMDEVKAHSEDIVLFIDEI
HTIVGAGAAEGAMDAGNMLKPSLARGELHVIGATTLDEYRKRIEKDAALERRFQPVVVPEPTAEQAIEIL
RGLKDRYESHHRVRIADQALVAAVELSDRYVTGRFLPDKAIDLVDQAAARVRLRLTLPPERLVNAEHEVV
KVKRSLAEARDRKAEPRIQELEAKLNAAEREVQSAQKERRTQKSGETPEVRAEDVAEVLSRMTGIPVTQM
TEDERKKLLELESRLHERVIGQDEAIRVLSQAIRRARAGLKDESRPIGSFLFLGPTGVGKTELAKTLAEL
LFGDEKALVRFDMSEYMEKHTVSRLVGAPPGYVGYEEGGQLTEAVRRRPYCVLLFDEVEKAHPDVFHMLL
QVLDDGRLTDAQGTVVNFKNTVIIGTSNLGSHLIQESTARKEPQERLRERVMGVLKGHFPPEFLNRIDET
VVFEPLNRAQLRAIVDLMLEKTRRMLHSQGIALEVTPAALEALVDKGWDPTFGARPLRREIQRAIEAPLA
ESLIAGDIHENSRVCADFKDGKFRFDEVEAAEPEREQAAASAVH
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|338529680|ref|NC_015711.1|:c7902412-7899758 Myxococcus fulvus HW-1 chromosome, complete genome
ATGGCCAACGTCTGCGACCTCTGCCACCAGCGCCCGGCGACCACCCGGGTCACCCGCGTCGCCGGGAACC
GGCGGACCACGGAGTCCCTGTGTGACGTCTGCAGCAGCCAGCGCTCGCGCTTCGGGCGCATGGGGTTGGG
CACGTCGCTCTTCGACCAGTTCTTCAGCGACTTCGGGGACGAGGACTTCGGGGGCCTGTCGCGCTCGCTC
CAGCAACCCGTGGAGCGCTACGACATCACCGAGGCCTTCTCCGATGAGACGCGGCGCGTGCTGGAGGGCG
CCTTCGAGGCGGCGCGCGGCGCGGGCGCGGCGTCCATCGACACCGAGCACCTGCTGGTGGCGCTCGCGAA
GGACCCGCTGGGGCGTACGGCGCTCAGCCGCATGAAGCTGGACCCGGCCCGGGTCGCCGAGCGCGCCGAG
TCCGAGCTGCGCCGTGGCAAGCGGCCCATGGAGCGCCCCGAGCTTTCGCCGCATGCGAAGCGGGCCCTGG
AGCTCGCGTACCAGGAGGCCTACGAGCTGGGGCACTCCTACGTGGGCCCCGAGCATGTGCTCCTGGGCCT
GCTCCAGGAAGGGGAGGGCCTGGCGTCGGAGCTCCTTCGCGAGCTGGGGGCCCAGCATGGCAAGGCCCGC
GCGTCCGTCGCGGAGTCGCTCGCCCCGTCCTCGGAGGCGCGGCGCTCGCCCACGCCCACGCTGGATGAGT
ATTGCCGAGACCTCACGAGCCTGGCGTCGGAGGGGAAGCTGGACCCGGTGGTGGGACGGGCCAACGAAAT
CGAGACCACGCTCGAAATCCTGTCGCGCCGCACGAAGAACAACCCGGTGCTCATCGGCGAGCCGGGCGTG
GGCAAGACGGCCATCGTGGAGGGCATCGCCCAGCGCATCATCTCCGCCGCCGTCCCGGACACGCTGCGCG
ACAAGCGCGTGCTGCAGCTCGACCTCTCCGGCCTGCTCGCGGGCAGCAAGTACCGCGGCGAGTTCGAGGA
GCGGCTGAAGAAGGTCATGGACGAGGTGAAGGCGCACAGCGAGGACATCGTCCTCTTCATCGACGAGATT
CACACCATCGTCGGCGCGGGCGCGGCGGAGGGCGCCATGGACGCGGGCAACATGCTCAAGCCGTCGCTGG
CGCGCGGCGAGCTGCACGTCATCGGCGCGACGACGCTGGACGAGTACCGCAAGCGCATCGAGAAGGACGC
CGCGCTGGAGCGCCGCTTCCAGCCGGTGGTCGTCCCGGAGCCCACGGCGGAGCAGGCCATCGAGATCCTG
CGGGGGCTCAAGGACCGCTACGAGTCACACCACCGCGTGCGCATCGCGGACCAGGCCCTGGTCGCGGCGG
TGGAGTTGTCGGACCGCTACGTCACCGGCCGCTTCCTGCCGGACAAGGCCATTGACCTGGTGGACCAGGC
GGCGGCGCGCGTGCGGCTGCGGTTGACGCTGCCACCGGAGCGGCTGGTGAACGCCGAGCATGAAGTGGTG
AAGGTGAAGCGCTCGCTCGCCGAGGCTCGGGACAGGAAGGCGGAGCCGCGCATCCAGGAGCTGGAGGCGA
AGCTGAACGCCGCCGAGCGTGAGGTGCAGAGCGCGCAGAAGGAGCGCCGCACGCAGAAGTCCGGTGAGAC
GCCGGAGGTCCGCGCCGAGGACGTGGCGGAGGTGCTGTCGCGCATGACGGGCATCCCCGTGACGCAGATG
ACGGAGGACGAGCGAAAGAAGCTCCTGGAGCTGGAGTCCCGACTGCACGAGCGCGTCATCGGCCAGGATG
AGGCCATCCGCGTGTTGTCGCAGGCCATCCGGCGGGCGAGGGCGGGGCTCAAGGACGAGTCGCGGCCCAT
CGGCTCCTTCCTCTTCCTGGGCCCCACGGGCGTGGGCAAGACGGAGCTGGCGAAGACGCTGGCGGAGCTG
CTCTTCGGCGACGAGAAGGCGCTCGTCCGCTTCGACATGAGCGAGTACATGGAGAAGCACACCGTGAGCC
GGCTGGTGGGCGCGCCGCCGGGCTACGTGGGCTACGAGGAGGGCGGACAGCTCACGGAGGCGGTGCGGCG
CAGGCCCTACTGCGTGCTCCTCTTCGACGAGGTGGAGAAGGCCCACCCCGACGTGTTCCACATGCTGCTC
CAGGTGCTGGATGACGGGCGACTCACGGACGCGCAGGGCACGGTGGTGAACTTCAAGAACACCGTCATCA
TCGGCACCAGCAACCTGGGCTCGCACCTCATCCAGGAGTCCACCGCGCGCAAGGAGCCCCAGGAGCGCCT
GCGCGAGCGCGTCATGGGCGTGCTCAAGGGCCACTTCCCGCCGGAGTTCCTCAACCGCATCGATGAGACC
GTGGTCTTCGAGCCGCTGAACCGCGCGCAGCTCCGCGCCATCGTGGACCTGATGCTGGAGAAGACGCGCC
GCATGCTCCACAGCCAGGGCATCGCGCTGGAGGTGACGCCCGCCGCGCTGGAGGCCCTGGTGGACAAGGG
TTGGGATCCGACCTTCGGCGCGCGCCCGCTGCGGCGTGAAATCCAGCGCGCCATCGAAGCGCCGCTCGCG
GAGTCGCTCATCGCTGGGGACATCCATGAGAACAGCCGCGTGTGCGCGGATTTCAAGGACGGAAAATTCC
GGTTTGATGAGGTGGAGGCCGCGGAGCCGGAGCGCGAGCAGGCTGCGGCGAGCGCCGTTCACTGA