SecReT6
Protein ID: 339492185
SecReT6 ID452
T6SS typeN/A
Gene symbol-
Locus tagPSTAB_0108
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]121942..123966 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDF8H461
KEGG IDpsz:PSTAB_0108
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-72, Aligned region: 29..323
Phage_base_V [PF04717], Evalue: 1.90E-23, Aligned region: 371..464
DUF2345 [PF10106], Evalue: 0.0001, Aligned region: 574..616
Protein Sequence: 674 a.a.     [Download]
>gi|339492185|ref|YP_004712478.1| Rhs element Vgr protein [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MFNAANKTHFTLSLEGVEHDFKVLEFRGREAISQPYRFDVELVSERPDLDLESLLHRPAFLAFAPDGSGV
HGLVHQAAQGESGQRLTRYRLTLVPQLAYLAHRTNQRIFQHLTVPQIVAQVLEEHGIQADAYSFQLGPVI
YPPREYCVQYDETDLHFIQRLCEEEGIHYHFQHSAAGHVLVFGDDQTVFPRLTATAYQQDSGLVADQPVI
KRFGLRLETRTSRVTRRDYDFEKPRLSMEAALHSDFQPDLEDYDYPGRFTERARGKHLSQRALERHRHDY
ELADGESDQPRLVSGHFLPLTEHPRSDWNQLWLLTEVLHEGKQPQVLEESVASHVDSGDGFVQGYRNRFS
ATPWDSPFRPALRHPKPKVLGSQTAVVTGPAGEEIHCDEYGRVKIQFHWDREAQADDKTSCWMRVSSSWA
GDRYGGIAIPRVGMEVLVTFLEGDPDQPLVTGCLYHKEHQVPYDLPANKTRTVFKTLSSPGGGGCNELRI
EDRKGAEQIYLHAQRDWDENIEHDQKIRVGHERHDTVEANSYSELKAEEHLIVAGDRKVEIKPDDHLTVG
QTQHIKLGTAQLTRAGREIHLKAGQKMVIEAGVELTLKAGGSFIKLDPGGITVSGPLARINAGGAPGKGS
GIKIKSPVLPGMSDRDKAGRLLEQAPASPLKPKHKVKRMMNFSG
 
Nucleotide Sequence: 2025 bp     [Download]
>gi|339492077|ref|NC_015740.1|:c123966-121942 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGTTCAACGCGGCCAATAAAACCCACTTCACGCTTTCCCTCGAAGGCGTCGAGCACGACTTCAAGGTGC
TCGAATTCCGGGGCCGCGAGGCCATCAGCCAGCCTTATCGCTTCGACGTGGAACTGGTCAGCGAGCGCCC
CGACCTGGATCTGGAAAGCCTGTTGCATCGCCCGGCTTTTCTTGCCTTCGCGCCGGATGGCAGTGGTGTT
CATGGGCTGGTGCATCAGGCCGCCCAGGGTGAATCCGGCCAGCGTCTGACCCGCTATCGCCTCACGCTCG
TGCCGCAGCTGGCCTACCTCGCCCATCGCACCAACCAGCGCATCTTCCAGCACCTGACGGTGCCGCAGAT
CGTCGCCCAGGTACTTGAGGAGCATGGTATCCAAGCCGATGCCTACAGCTTCCAACTCGGCCCGGTTATT
TACCCACCGCGCGAATATTGCGTGCAGTACGACGAGACCGACCTGCACTTCATCCAGCGCCTGTGCGAGG
AAGAGGGCATCCACTATCACTTCCAGCACAGCGCGGCCGGTCATGTGCTGGTCTTCGGCGATGACCAGAC
GGTCTTCCCCAGGCTCACCGCCACCGCCTATCAGCAGGACAGCGGTCTGGTCGCCGACCAGCCGGTGATC
AAGCGTTTCGGCCTGCGCCTGGAAACCCGTACCAGCCGCGTCACGCGCCGCGACTACGACTTCGAAAAGC
CGCGCCTGTCCATGGAGGCCGCGCTCCACAGCGACTTCCAACCTGATCTCGAAGACTACGACTACCCCGG
CCGCTTCACCGAGCGCGCCCGCGGCAAGCATCTGTCGCAGCGCGCCCTGGAACGCCACCGCCACGACTAC
GAGCTGGCCGACGGCGAGAGCGACCAGCCGAGGCTGGTGAGCGGACATTTCCTCCCGCTCACCGAACACC
CGCGCAGCGACTGGAACCAGCTCTGGCTTCTTACCGAAGTGCTGCACGAAGGCAAGCAGCCGCAGGTGTT
GGAGGAGTCCGTCGCCAGTCATGTCGATAGCGGTGACGGCTTCGTCCAGGGCTACCGCAACCGCTTCAGC
GCCACCCCCTGGGACAGCCCCTTCCGCCCGGCGCTTCGCCATCCGAAACCGAAGGTGCTCGGCAGCCAGA
CCGCCGTGGTTACCGGCCCCGCTGGCGAAGAGATCCACTGCGACGAGTACGGCCGCGTAAAAATCCAGTT
CCACTGGGACCGCGAAGCCCAGGCCGATGACAAGACCAGCTGCTGGATGCGCGTCAGCTCCAGCTGGGCG
GGTGACCGCTATGGCGGCATCGCCATCCCGCGGGTCGGCATGGAAGTGCTGGTGACCTTCCTCGAAGGCG
ATCCCGATCAACCGCTGGTGACCGGCTGCCTGTACCACAAGGAACACCAGGTCCCTTACGACCTGCCGGC
CAACAAGACCCGCACGGTGTTCAAGACCCTGAGCAGCCCGGGTGGTGGTGGCTGCAACGAACTGCGCATC
GAAGACCGCAAGGGTGCCGAACAGATCTACCTCCACGCCCAGCGCGACTGGGACGAGAACATCGAGCACG
ACCAGAAGATCCGCGTCGGCCACGAGCGCCACGACACGGTGGAAGCCAACAGCTACAGCGAGCTTAAGGC
TGAGGAACATCTCATCGTCGCAGGTGATCGCAAGGTGGAAATCAAACCCGACGACCACCTCACCGTCGGC
CAGACCCAACACATCAAGCTCGGCACCGCCCAGCTGACCAGGGCCGGCCGCGAGATCCACCTCAAAGCCG
GGCAAAAGATGGTCATCGAAGCCGGCGTCGAACTGACCCTGAAGGCCGGCGGCAGCTTCATCAAGCTCGA
CCCGGGCGGCATCACCGTCTCCGGCCCGCTGGCACGAATCAACGCCGGCGGCGCGCCAGGCAAGGGCTCG
GGAATCAAGATCAAATCACCGGTGCTGCCGGGAATGTCGGATAGGGATAAGGCCGGGAGGTTGTTGGAGC
AGGCGCCCGCCAGTCCGCTCAAGCCAAAACATAAAGTCAAAAGAATGATGAATTTTTCAGGTTGA