SecReT6
Protein ID: 339492188
SecReT6 ID452
T6SS typeN/A
Gene symbol-
Locus tagPSTAB_0111
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]129227..130108 [-]
Producthypothetical protein
NoteTssL
UniProt IDF8H464
KEGG IDpsz:PSTAB_0111
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.70E-72, Aligned region: 61..266
Protein Sequence: 293 a.a.     [Download]
>gi|339492188|ref|YP_004712481.1| hypothetical protein PSTAB_0111 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MIKEMDYGQDDRTVIVNRGGEAPAQSPLTDFDTPPRFEQLEERMIYAARLRPAETFNISLNPLVAAASPL
LSEVVRFKHSLESEDLQALHGQLSSAIKLFEHRALHDGAESSQVMAARYVLCTVLDEAVVTTPWGNESEW
SQMSLLSSFHNETFGGEKFFQLLERLSRNPVKHLPMLELMYLCLSLGFEGKYRVLPRGMLELEAVRDSLY
RQIRQMRGDIPRELSPHWEGLKDTRRRLVRIVPWWMVALFTLVCLGVIYGGFAWVLGEQREAVLQPYRSL
DMDAGGSTFSGMK
 
Nucleotide Sequence: 882 bp     [Download]
>gi|339492077|ref|NC_015740.1|:c130108-129227 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGATCAAGGAAATGGATTACGGACAGGACGACCGCACGGTCATCGTCAATCGAGGAGGAGAGGCCCCGG
CGCAGAGCCCGCTGACCGACTTCGACACCCCGCCGCGCTTCGAGCAGCTGGAGGAGCGAATGATCTACGC
GGCGCGCCTGCGCCCGGCGGAAACCTTCAACATCAGCCTCAACCCGCTGGTGGCCGCCGCCTCGCCGCTG
CTGTCGGAAGTGGTGCGCTTCAAGCACAGCCTGGAAAGCGAGGACCTGCAGGCCCTGCACGGCCAGTTGA
GCAGCGCGATCAAGCTGTTCGAGCATCGCGCGCTGCATGACGGTGCCGAAAGCAGCCAGGTGATGGCGGC
GCGCTACGTGCTCTGCACCGTGCTCGACGAGGCCGTGGTGACCACGCCCTGGGGCAACGAAAGCGAATGG
TCGCAGATGAGCCTGCTGTCCTCCTTCCACAACGAGACCTTCGGCGGCGAGAAGTTCTTCCAGCTGCTCG
AGCGGCTGTCGCGCAACCCGGTCAAGCACCTGCCGATGCTCGAGCTGATGTACCTCTGCCTGTCGCTCGG
CTTCGAGGGCAAGTATCGCGTGCTACCGCGCGGCATGCTCGAGCTGGAAGCGGTACGCGACAGCCTCTAC
CGACAGATTCGCCAGATGCGCGGCGATATACCGCGTGAGCTGTCGCCGCACTGGGAAGGCCTCAAGGACA
CCCGCCGACGTCTGGTGCGCATCGTGCCCTGGTGGATGGTGGCGCTGTTTACCCTGGTCTGTCTCGGGGT
GATTTACGGCGGCTTCGCCTGGGTGCTCGGCGAACAACGCGAGGCCGTGCTGCAACCCTACCGCTCGCTG
GACATGGATGCCGGCGGTTCCACCTTTTCAGGGATGAAATGA