SecReT6
Protein ID: 339492189
SecReT6 ID452
T6SS typeN/A
Gene symbol-
Locus tagPSTAB_0112
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]130114..131445 [-]
Producthypothetical protein
NoteTssK
UniProt IDF8H465
KEGG IDpsz:PSTAB_0112
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.10E-148, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|339492189|ref|YP_004712482.1| hypothetical protein PSTAB_0112 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MSLHKVVWQEGMLLRPQHFQQSDRYYDHQLKARTQKLSSYAWGFFNLEIDRQFLNMGKLVLSQASGILPD
GTLFELGSEREPLALDIPPNTGSTPVYLALPLVTGNHIETRRPEQKDVLARYTAHELDVADSNAGDSSTS
QVSTGLPDFRLLLGEQQSDQAYVKLQLCEVLDTTPDGVISLDPEFIPTYVNFQASAYLLSCLKEVISMLA
HRGDTLAERISATGKVGGAEVGDFMMLQLINRHEPVLRHYLGVEQVHPEQIYRDLLGLLGELATFSSESK
RPRLDGRYQHSDQGASFRKLMDAIRQVLSMVLEQHAIELLLQQRQYGIQVSPLHDHKLLGTASFVLAASA
QCDSETLRTRLPAHLKIGPVERIRQLVNLHLPGIRLKPLPVAPRQIPFHAGKTYFALELSAEDQAQLERS
GGFAFHVSGDFAGLELKFWAVRD
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|339492077|ref|NC_015740.1|:c131445-130114 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGAGCCTGCACAAGGTTGTCTGGCAGGAAGGCATGCTGCTGCGCCCGCAGCACTTCCAGCAAAGCGATC
GATACTACGATCACCAACTCAAGGCGCGCACCCAGAAGCTGAGCAGCTATGCCTGGGGATTCTTCAATTT
GGAGATCGACCGCCAGTTCCTCAACATGGGCAAGCTGGTGCTCAGCCAGGCCAGCGGCATCCTCCCGGAC
GGGACCCTGTTCGAGCTGGGCAGCGAGCGCGAGCCTCTGGCTCTGGACATCCCGCCGAATACCGGCAGCA
CTCCGGTCTATCTCGCGCTGCCGCTGGTCACCGGCAACCACATCGAAACCCGCCGGCCCGAGCAGAAGGA
CGTGCTGGCGCGCTATACCGCCCACGAACTGGACGTCGCCGACTCCAATGCCGGCGACAGCAGCACGAGC
CAGGTCAGCACCGGTCTGCCAGATTTCCGCCTGCTGCTGGGCGAGCAGCAGAGCGACCAGGCCTACGTGA
AACTGCAGCTGTGTGAGGTGCTGGACACCACGCCGGACGGGGTCATCAGCCTCGACCCCGAGTTCATCCC
CACCTATGTCAACTTCCAGGCCTCCGCCTATCTGCTGTCCTGCCTGAAGGAAGTGATCAGCATGCTCGCC
CACCGCGGCGATACCCTTGCCGAGCGAATCAGCGCCACCGGCAAGGTGGGTGGCGCCGAGGTCGGCGACT
TCATGATGCTGCAGCTGATCAACCGTCACGAACCGGTGCTGCGCCACTACCTGGGCGTGGAGCAGGTGCA
TCCGGAGCAGATCTACCGGGATCTGCTTGGCCTGCTCGGCGAGCTGGCGACCTTCTCCAGCGAGAGCAAG
CGCCCGCGCTTGGATGGCCGTTACCAGCACAGTGATCAGGGCGCGAGCTTCCGCAAGCTGATGGACGCGA
TCCGCCAGGTATTGTCGATGGTGCTCGAGCAGCACGCCATCGAGCTGCTGCTGCAGCAGCGTCAGTACGG
CATCCAGGTATCGCCGCTGCATGACCACAAGCTGCTAGGCACGGCGTCCTTCGTGCTCGCCGCCAGCGCC
CAGTGCGATTCGGAAACCCTGCGCACACGGCTGCCGGCGCACCTGAAGATCGGCCCGGTGGAACGCATCC
GTCAGTTGGTCAACCTGCATCTGCCGGGCATCCGCCTCAAGCCGCTGCCGGTGGCGCCGCGGCAGATCCC
CTTCCATGCCGGCAAGACCTATTTCGCCCTGGAGCTCAGCGCCGAGGACCAGGCGCAGCTGGAGCGTTCC
GGTGGCTTTGCCTTCCATGTGTCCGGTGACTTCGCCGGGCTCGAACTGAAATTCTGGGCGGTCAGGGACT
GA