SecReT6
Protein ID: 339492190
SecReT6 ID452
T6SS typeN/A
Gene symbol-
Locus tagPSTAB_0113
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]131448..131930 [-]
Producthypothetical protein
NoteTssJ
UniProt IDF8H466
KEGG IDpsz:PSTAB_0113
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-39, Aligned region: 13..149
Protein Sequence: 160 a.a.     [Download]
>gi|339492190|ref|YP_004712483.1| hypothetical protein PSTAB_0113 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MPRRITLAMLASLLVLGGCSALSPYSKLTKLDLELHGSARLNPDLNGRPSPIVLRLLELKHPVAFENGEF
FALYQRPKEALAPDLVTSEELELRPGESRELKLSVQDGSRYVGVLAAYRDLPEASWRYVIAVPPQERTRI
ALSLDERGIALFDPLAEEGK
 
Nucleotide Sequence: 483 bp     [Download]
>gi|339492077|ref|NC_015740.1|:c131930-131448 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGCCTCGTCGCATCACCCTGGCCATGCTGGCCTCGCTGCTCGTGCTGGGCGGCTGCTCGGCACTGTCAC
CGTACTCCAAGCTGACCAAGCTGGACCTCGAGCTGCACGGCAGCGCCCGTCTCAACCCCGACCTCAACGG
CCGGCCTTCGCCGATCGTGCTGCGCCTGCTGGAGCTCAAGCATCCGGTGGCGTTCGAAAACGGCGAGTTC
TTCGCCCTCTACCAGCGGCCCAAGGAAGCACTGGCGCCAGACCTGGTGACCTCCGAGGAACTGGAACTGC
GTCCCGGCGAAAGCCGTGAGCTGAAGCTCTCCGTGCAGGACGGCAGCCGCTACGTCGGCGTGCTGGCCGC
CTACCGCGACCTGCCGGAAGCCAGCTGGCGCTACGTCATCGCCGTGCCGCCGCAAGAGCGCACCCGCATC
GCCCTGAGCCTGGACGAGCGCGGCATCGCGCTGTTCGACCCGCTCGCCGAAGAAGGAAAATAA