SecReT6
Protein ID: 339496153
SecReT6 ID453
T6SS typei1
Gene symbol-
Locus tagPSTAB_4076
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]4400619..4402181 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDF8H6N3
KEGG IDpsz:PSTAB_4076
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.00E-22, Aligned region: 54..114
Protein Sequence: 520 a.a.     [Download]
>gi|339496153|ref|YP_004716446.1| ImpA domain-containing protein [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MHASALSKHYLELARKPVNDSNFAGDDIRYSSEFELLEAELAKAGALHQTTGIDWQKVREGSETLLTSLS
KDLRAAAWLTWSLFQRESFAGLQAGLSVLHYLCSNHWAELHPRKPRTRAAAINWLLPRLEQTFSEDVPVG
EQLALFRSLAEQLHALEQCLSGHLGEDAPLLLPLCRQLDGMVKRASSGQSQPGTVGAAIAQVKQVASQVF
APGAPIENDKEALKAVRNLQEQARPLTAWWLKQRTSDLRPLRLSRTLLWLSIDSLPEHNGEQVTALRGIP
ADKLANYRERFAQGLYADLLVDLENSTARAPFWLDGQRLAWECLQELAAEQAMREVEIQLALFLQRLPRL
EELRFHDGTPFADAETRAWISGQVLPHVQPAATTRQEEPPASGSIQPSWELALQEALPLLRKEGLKPAVQ
QLKQGLARARGGRERFFWQLSLARLCYQAKKYELAKTQLEALDQQLEASGLGSWEPDLALEVLRLLHSCC
ELLPQNHAVRESKDEIYRRLCHLDLEVVLD
 
Nucleotide Sequence: 1563 bp     [Download]
>gi|339492077|ref|NC_015740.1|:4400619-4402181 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGCACGCCAGCGCACTCAGCAAGCATTATCTGGAACTTGCCAGAAAGCCGGTCAATGACAGCAATTTCG
CTGGCGATGATATTCGCTACAGCAGCGAATTCGAATTGCTCGAGGCCGAGCTGGCCAAGGCCGGAGCGCT
ACACCAGACCACTGGCATCGACTGGCAGAAGGTCCGCGAGGGCAGCGAGACGCTGCTCACCTCGCTGTCC
AAGGACCTGCGCGCCGCCGCCTGGCTGACCTGGAGCCTGTTCCAGCGTGAGTCCTTTGCCGGGTTGCAGG
CCGGCCTGAGCGTTCTGCACTACCTGTGCAGCAATCACTGGGCCGAGCTGCATCCCCGCAAGCCGCGCAC
GCGCGCCGCCGCGATCAACTGGCTGCTGCCGCGGCTGGAACAGACCTTTTCCGAAGACGTCCCGGTCGGC
GAACAGCTGGCGCTGTTCCGCAGCCTGGCCGAGCAACTGCATGCGCTGGAGCAGTGCCTGTCCGGTCATC
TCGGCGAAGATGCTCCATTGCTGCTGCCGCTATGCCGCCAGCTCGACGGCATGGTCAAGCGCGCCAGCTC
GGGGCAATCGCAACCCGGGACGGTCGGCGCAGCCATCGCCCAGGTGAAACAGGTCGCCAGCCAGGTCTTC
GCCCCCGGCGCGCCGATCGAGAATGACAAGGAAGCGCTCAAGGCGGTGCGCAACCTGCAGGAGCAGGCGC
GTCCGCTCACAGCCTGGTGGCTGAAGCAGCGCACCAGCGATTTGCGGCCGCTGCGCCTGTCACGCACGCT
CCTGTGGCTGAGCATCGACAGCCTGCCGGAGCACAACGGCGAGCAGGTCACCGCCCTGCGTGGGATACCT
GCCGACAAGCTGGCCAACTACCGCGAACGTTTCGCCCAGGGCCTGTATGCGGACCTGCTGGTGGACCTGG
AGAACAGCACCGCGCGTGCCCCGTTCTGGCTGGACGGTCAGCGCCTGGCCTGGGAGTGCCTGCAGGAGCT
GGCGGCCGAACAGGCCATGCGCGAGGTGGAGATTCAGCTCGCGTTGTTCCTGCAGCGCCTGCCGCGTCTG
GAGGAGCTGCGCTTCCACGACGGCACGCCGTTCGCCGACGCCGAAACCCGCGCCTGGATCAGCGGCCAGG
TCCTGCCACATGTGCAGCCTGCTGCCACAACGAGACAGGAAGAGCCGCCTGCTTCCGGCAGCATACAGCC
GAGCTGGGAGCTGGCGTTGCAGGAAGCGCTGCCCCTGTTGCGCAAGGAAGGCCTCAAACCCGCCGTGCAG
CAGCTCAAACAGGGCCTTGCTCGCGCCCGTGGCGGCCGTGAGCGATTTTTCTGGCAACTGAGCCTCGCCC
GCCTGTGCTACCAGGCCAAGAAATACGAGCTGGCCAAAACCCAGCTCGAAGCACTCGACCAGCAGCTCGA
GGCCAGCGGCCTGGGCAGCTGGGAACCCGATCTCGCCCTCGAGGTACTGCGCCTGCTGCACAGCTGTTGC
GAGCTGTTGCCGCAGAACCACGCCGTGCGTGAAAGCAAGGATGAGATTTACCGCAGGCTGTGCCACCTCG
ATCTCGAAGTGGTGCTGGACTAA