SecReT6
Protein ID: 339496154
SecReT6 ID453
T6SS typei1
Gene symbol-
Locus tagPSTAB_4077
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]4402199..4402705 [+]
Producthypothetical protein
NoteTssB
UniProt IDF8H6N4
KEGG IDpsz:PSTAB_4077
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-55, Aligned region: 5..159
Protein Sequence: 168 a.a.     [Download]
>gi|339496154|ref|YP_004716447.1| hypothetical protein PSTAB_4077 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MAKEGSVAPKERINVTFKPATGNAQEEVELPLKLMVLGDFTQRADDRKIEDRKPIAIDKNSFDEVLAKQE
LNLTFGVPNRLQDEQTDDELAVQLRINSMKDFNPANLVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IESVLADDDSRDRVLGELGLAAKEKLDA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|339492077|ref|NC_015740.1|:4402199-4402705 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGGCCAAAGAAGGCTCGGTTGCACCCAAGGAACGCATCAACGTCACGTTCAAGCCGGCCACCGGCAACG
CTCAGGAAGAGGTCGAGCTGCCCCTCAAGCTGATGGTGCTGGGCGATTTCACCCAGCGCGCCGACGACCG
CAAGATCGAAGACCGCAAGCCCATCGCCATCGACAAGAACAGCTTCGACGAGGTCCTGGCCAAGCAGGAG
CTGAACCTGACCTTCGGCGTGCCGAACCGCCTGCAGGACGAGCAGACCGATGACGAGTTGGCCGTGCAGC
TGCGCATCAACTCGATGAAAGACTTCAATCCGGCAAACCTGGTCGAGCAGGTCCCGGAGCTGAAGAAACT
GATGGAACTGCGCGACGCCCTGGTCGCCCTGAAGGGTCCGCTGGGCAACGCTCCGGCCTTCCGCAAGGCC
ATCGAAAGCGTACTCGCCGATGACGACTCGCGTGACCGCGTACTCGGCGAACTGGGCCTGGCGGCCAAAG
AGAAGCTGGACGCCTGA