SecReT6
Protein ID: 339496155
SecReT6 ID453
T6SS typei1
Gene symbol-
Locus tagPSTAB_4078
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]4402732..4404210 [+]
Producthypothetical protein
NoteTssC
UniProt IDF8H6N5
KEGG IDpsz:PSTAB_4078
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.80E-192, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|339496155|ref|YP_004716448.1| hypothetical protein PSTAB_4078 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MTTSAAAVEHGNHLAEGGILDRIIAETRLTPDDEAYDIAKRGVSAFIEELLKPQNENEPVKKAMVDRMIA
EIDAKLSRQMDEILHHPQFQALESSWRGLKLLVDRTNFRENIKLELLNASKQDLLDDFEDSPEIVQSGLY
KHIYTAEYGQFGGQPVGALIANYFFDPSAPDVKTMQYVASVASMSHAPFIAAAGPKFFGLESFTGLPDLK
DLKDHFEGPQFTKWQSFREQEDARYVGLTVPRFLLRNPYDPEDNPVKSFVYKENVAGSHEHYLWGNTAYA
FASRLTDSFAKFRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFIALTMR
KGSDNAAFFSANSAQKPKFFGNSEEGKTAELNYKLGTQLPYLFIVNRLAHYLKVLQREQIGAWKERTDLE
LELNKWIRQFVADQENPSSEVRSRRPLRAAQVNVSDVEGEPGWYRVSLSVRPHFKYMGADFTLSLVGKLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|339492077|ref|NC_015740.1|:4402732-4404210 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGACCACTAGCGCAGCCGCCGTCGAGCACGGCAATCACCTCGCCGAAGGCGGCATTCTCGACCGCATCA
TCGCCGAAACCCGCCTGACCCCGGACGACGAGGCCTACGACATCGCCAAGCGCGGCGTATCGGCCTTCAT
CGAGGAACTGCTCAAGCCGCAGAACGAAAACGAGCCGGTGAAGAAGGCAATGGTCGACCGCATGATCGCG
GAGATCGACGCCAAGCTCAGCCGGCAGATGGACGAAATCCTTCACCACCCACAGTTCCAGGCGCTGGAGT
CCTCCTGGCGTGGCCTGAAGCTGCTGGTGGATCGCACGAACTTTCGCGAAAACATCAAGCTCGAACTGCT
CAACGCCTCCAAGCAAGACCTGCTGGACGACTTCGAGGACAGCCCTGAAATCGTCCAGTCCGGCCTGTAC
AAGCACATCTACACGGCCGAGTACGGCCAGTTCGGTGGCCAGCCGGTCGGTGCGCTGATCGCCAACTACT
TCTTCGATCCCAGCGCGCCCGACGTCAAGACCATGCAGTACGTCGCCAGCGTCGCGAGCATGTCCCATGC
GCCGTTCATCGCCGCTGCCGGCCCGAAATTCTTCGGCCTGGAAAGCTTCACCGGCCTGCCGGACCTTAAG
GACCTCAAGGATCACTTCGAGGGCCCGCAGTTCACCAAATGGCAGAGCTTCCGCGAACAAGAAGATGCCC
GCTATGTCGGCCTGACCGTCCCGCGGTTCCTACTGCGCAATCCGTACGATCCGGAAGACAACCCGGTGAA
GAGCTTCGTCTACAAGGAAAACGTCGCCGGCAGCCACGAGCACTACCTGTGGGGCAACACCGCCTACGCC
TTCGCCAGCCGGCTGACCGACAGCTTCGCCAAGTTCCGCTGGTGCCCGAACATCATCGGGCCGCAGAGCG
GCGGCGCAGTGGAAGACCTGCCGCTGCACCATTTCGAAAGCATGGGCGAGATCGAGACCAAGATCCCGAC
CGAGGTGCTGGTTTCCGACCGTCGCGAGTACGAGCTGGCCGAGGAAGGCTTTATCGCCCTGACCATGCGC
AAGGGCAGCGACAACGCCGCCTTCTTCTCCGCCAACTCGGCGCAGAAGCCGAAGTTCTTCGGCAACAGTG
AGGAAGGCAAGACCGCCGAACTGAACTACAAGCTCGGCACCCAGCTGCCCTACCTGTTCATCGTCAACCG
CCTGGCGCACTACCTGAAGGTGCTGCAGCGCGAGCAGATCGGTGCATGGAAGGAGCGCACCGACCTCGAA
CTGGAACTGAACAAGTGGATCCGCCAGTTCGTCGCCGACCAGGAGAATCCGAGCTCCGAAGTACGCAGCC
GTCGTCCGCTGCGCGCCGCCCAAGTCAACGTCAGCGACGTCGAGGGCGAACCGGGCTGGTATCGCGTCAG
CCTCAGCGTGCGTCCGCACTTCAAGTACATGGGCGCGGATTTCACCCTGTCGCTGGTTGGCAAGCTGGAC
AAGGAATAA