SecReT6
Protein ID: 339496156
SecReT6 ID453
T6SS typei1
Gene symbol-
Locus tagPSTAB_4079
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]4404215..4404622 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDF8H6N6
KEGG IDpsz:PSTAB_4079
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-19, Aligned region: 25..114
Protein Sequence: 135 a.a.     [Download]
>gi|339496156|ref|YP_004716449.1| GPW/gp25 family protein [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MNGYGSLFERLGGDAARRSGWSREVAAMASVAAHLAKMLSTRAGSVQTLPDYGLPDLNDMRLSLHDSLQQ
ARIAIERFIEAYEPRLTQVRVLSLPRTHDPLTLAFTIEGLLEVDGLKRQVSFSASLDGSGQVKVQ
 
Nucleotide Sequence: 408 bp     [Download]
>gi|339492077|ref|NC_015740.1|:4404215-4404622 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
TTGAACGGATACGGCAGCCTCTTCGAACGCCTCGGCGGTGACGCCGCGCGACGTTCCGGCTGGAGCCGCG
AGGTCGCGGCAATGGCCTCGGTGGCTGCCCATCTGGCCAAGATGCTCAGCACCCGAGCGGGCAGCGTGCA
GACGCTGCCCGACTACGGGTTGCCAGATCTCAACGATATGCGCCTGTCGCTGCACGACTCGCTGCAGCAG
GCGCGTATCGCCATCGAGCGCTTCATCGAAGCGTACGAACCCAGGTTGACCCAGGTGCGCGTGCTGTCGC
TGCCGCGAACCCACGACCCGCTGACCCTCGCCTTCACCATCGAAGGCCTGCTGGAAGTGGATGGCCTCAA
GCGCCAGGTCAGCTTCTCCGCCAGCCTGGATGGCAGCGGGCAGGTCAAGGTCCAGTAA