SecReT6
Protein ID: 339496160
SecReT6 ID453
T6SS typei1
Gene symbol-
Locus tagPSTAB_4083
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]4407604..4409394 [+]
Producthypothetical protein
NoteTssF
UniProt IDF8H6P0
KEGG IDpsz:PSTAB_4083
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.50E-190, Aligned region: 3..596
Protein Sequence: 596 a.a.     [Download]
>gi|339496160|ref|YP_004716453.1| hypothetical protein PSTAB_4083 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MSFNHYYQSELTALRQLGKRFAERSPALAPFLGQAGRDPDVERLLEGFAFLTGRLRQKLDDELPELTHSL
MHLLWPNYMRPLPAFSMLQFDPLKRPGPALTVPRNTPVESNPVQGVSCCFRTAYATEVLPLALQALEYSV
KGTGALLSLRLQMSADGNLGEIGLSHLRLHLAGEPYISQLLYLSLLRHLGGIELVLLNEQGHPLTGPDGR
PLTPLQLTAKQVEPVGFTEDEALIPYPLNTFRGYRYLQEYFAFPDKFLFVDLKGLEIIQRIPEDLLKQAR
GLELRFDIHKAGVQRIRPTLDNVRLYCTPVVNLFPHDAIPIRLDGKQDQYLLLPAEYDAQQCGVFSVDRV
TGWKPGGMGYEEYVPFESFEHDPSFDVPVARPHYSVRQQPSLLGEGQETWLSFGLRNLDQHETLSIELTC
TNQNLPRQLKLGDICKPCEDTPEFLSFRNISAVTPSYAPPLQRDYLWKLISNMSLNYLSLANVEALKVIL
ETYDLPRYYDKHADNVSRRRLGGLTHIAHQHVDRLHRGLPVRGVRTELTMNQDGFIGEGDLFLFASVLNE
FLALYASLNSYHELRVQSTQGEVYQWTPRMGQQPLL
 
Nucleotide Sequence: 1791 bp     [Download]
>gi|339492077|ref|NC_015740.1|:4407604-4409394 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGTCTTTCAACCATTACTACCAGAGCGAGCTCACCGCCCTGCGCCAGCTGGGCAAGCGCTTCGCCGAGC
GCAGCCCGGCGCTCGCGCCGTTCCTCGGCCAGGCCGGGCGCGATCCGGATGTCGAGCGGCTGCTCGAAGG
CTTCGCTTTTCTCACCGGGCGGCTGCGGCAGAAGCTCGATGACGAGCTGCCGGAGCTGACCCACTCGCTG
ATGCATCTGCTGTGGCCGAACTACATGCGTCCGCTGCCAGCCTTCAGCATGCTGCAGTTCGATCCGCTGA
AGCGCCCCGGCCCTGCACTGACGGTGCCGCGCAATACGCCAGTGGAATCCAATCCTGTGCAGGGCGTCAG
CTGCTGCTTTCGTACCGCCTACGCCACCGAGGTGCTGCCTCTGGCATTGCAGGCGCTGGAGTATTCGGTC
AAGGGCACCGGTGCGCTGCTCAGCCTGCGCCTGCAGATGAGCGCCGATGGCAATCTCGGCGAGATCGGCC
TCAGCCATCTCCGCCTGCACCTGGCGGGCGAGCCCTATATCAGCCAGCTGCTCTACCTCAGCCTGTTGCG
GCATCTGGGCGGCATCGAGCTCGTGCTGCTGAACGAACAGGGCCACCCGCTGACCGGTCCCGATGGCCGA
CCGCTGACGCCCTTGCAGCTCACCGCCAAGCAGGTCGAACCGGTGGGATTCACCGAGGATGAGGCGCTGA
TCCCCTACCCGCTCAATACCTTCCGCGGTTATCGCTACCTGCAGGAATATTTCGCCTTCCCCGACAAGTT
TCTCTTCGTCGACCTAAAGGGCCTTGAGATCATTCAGCGCATTCCGGAGGATCTGCTCAAGCAGGCCCGC
GGCCTGGAGCTGCGCTTCGACATTCACAAGGCCGGCGTGCAACGCATCCGCCCGACGCTGGACAACGTGC
GCCTGTACTGTACGCCGGTGGTAAACCTGTTCCCGCACGATGCCATCCCGATCCGCCTGGACGGCAAGCA
GGACCAGTACCTGCTGCTGCCGGCCGAGTACGATGCGCAGCAATGCGGCGTGTTTTCGGTGGATCGGGTC
ACCGGCTGGAAACCCGGCGGCATGGGCTACGAAGAGTACGTGCCGTTCGAATCCTTCGAGCATGACCCCA
GCTTCGATGTGCCGGTGGCGCGCCCGCACTACAGCGTGCGCCAGCAACCTTCGCTGCTGGGCGAAGGCCA
GGAAACCTGGCTCAGCTTCGGCCTGCGCAACCTCGACCAGCACGAGACGCTGTCCATCGAGCTGACCTGC
ACCAACCAGAACCTGCCGCGCCAGCTGAAGCTCGGCGACATCTGCAAGCCCTGCGAAGACACCCCGGAAT
TTCTCAGCTTCCGCAATATCTCGGCGGTCACCCCGAGCTACGCGCCGCCGCTGCAGCGCGACTATCTGTG
GAAGCTGATCAGCAACATGTCGCTGAACTACCTGTCGCTGGCCAACGTCGAGGCGCTCAAGGTGATCCTC
GAGACCTACGACCTACCACGCTATTACGACAAGCACGCCGACAACGTCAGCCGGCGGCGCCTCGGCGGCC
TGACTCACATCGCCCACCAGCACGTCGATCGCCTGCATCGCGGGCTGCCGGTGCGTGGCGTACGTACCGA
ACTGACCATGAATCAGGACGGCTTCATTGGTGAGGGCGATCTGTTCCTCTTCGCCTCGGTGCTCAACGAA
TTCTTAGCCCTCTACGCCAGCCTCAACTCGTATCACGAGCTGCGCGTGCAGAGCACACAGGGAGAGGTGT
ACCAATGGACGCCGCGCATGGGTCAGCAACCGCTGCTCTGA